KEGG   Listeria monocytogenes HCC23: LMHCC_2288Help
Entry
LMHCC_2288        CDS       T00801                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lmh  Listeria monocytogenes HCC23
Pathway
lmh00010  Glycolysis / Gluconeogenesis
lmh00051  Fructose and mannose metabolism
lmh00562  Inositol phosphate metabolism
lmh01100  Metabolic pathways
lmh01110  Biosynthesis of secondary metabolites
lmh01120  Microbial metabolism in diverse environments
lmh01130  Biosynthesis of antibiotics
lmh01200  Carbon metabolism
lmh01230  Biosynthesis of amino acids
Module
lmh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lmh_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lmh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMHCC_2288 (tpiA)
   00051 Fructose and mannose metabolism
    LMHCC_2288 (tpiA)
   00562 Inositol phosphate metabolism
    LMHCC_2288 (tpiA)
Enzymes [BR:lmh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LMHCC_2288 (tpiA)
Exosome [BR:lmh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LMHCC_2288 (tpiA)
  Exosomal proteins of bladder cancer cells
   LMHCC_2288 (tpiA)
  Exosomal proteins of melanoma cells
   LMHCC_2288 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACK40626
Position
2261031..2261795
Genome map
AA seq 254 aa AA seqDB search
MRKPLVGINMKNYINTRAQTSEWLEATIPLLENFSDVDTFIFPSMGTLETTANLLAGTSF
GFGPQNMAPEKSGPLTGEFSVESIIDLNANYVEIGHAERKNLFHEKTSEIAKKIKLALDE
EITPVVCVGESLRANDTNELKSALHKQIEALFNTIQVAQFKNVVLAYEPEWAIGKANSAD
TSYIESAHQALREIIRELGGDETLVRIIYGGSVSKENAAEIVRQKNVDGLFVGRFGHKPQ
NFADIVSIVSKTKG
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaacccttagttggaattaatatgaaaaactatattaacactcgggctcagaca
tctgaatggttagaagcgactatccctcttcttgaaaatttttctgatgtggatacgttt
atctttccttctatgggcacactcgaaacgaccgccaaccttttagcggggacatcattt
ggctttggtccacaaaatatggcgccggagaaatccggcccgctaactggtgaattttcg
gtggaatctatcattgacttaaacgcgaactatgtcgaaattggtcacgcagaacgcaaa
aacctttttcacgagaaaactagcgagatagcgaaaaaaattaaactagcgctggacgaa
gaaatcactcctgtcgtatgcgttggggaaagccttcgcgcgaatgatacaaacgagttg
aaaagcgcccttcacaaacaaatcgaagcgctgtttaacaccattcaagtagcacaattt
aaaaatgttgttctggcttatgaaccagaatgggcaattggtaaggcaaattccgctgac
accagttacatcgaaagcgctcatcaagctttgcgagaaattattcgcgaactaggcggc
gatgaaacgctcgtaagaattatttacggtggctcggtcagcaaggaaaacgccgcagaa
attgtccgtcaaaaaaatgtcgatggtttattcgtcggaagatttggccataaaccgcaa
aattttgccgacattgtttctattgttagcaaaacgaaaggatga

DBGET integrated database retrieval system