KEGG   Listeria monocytogenes HCC23: LMHCC_2369Help
Entry
LMHCC_2369        CDS       T00801                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lmh  Listeria monocytogenes HCC23
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lmh01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:lmh00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2342566..2343705)
Genome map
AA seq 379 aa AA seqDB search
MERERKIQILKDIVNIDSTNGHEEQVANYLQKLFAEYGIESEKVQYDVDRASLVSEIGSN
DGKVLAFSGHMDVVDAGDVSKWKFPPFEAAEHEGKIYGRGATDMKSGLAAMVIAMIELHE
EKQKLNGKIRLLATVGEEVGELGAEQLTQKGYADDLDGLIIGEPSGHRIVYAHKGSINYT
VKSTGKNAHSSMPEFGVNAIDNLLLFYNEVEKFVKSIDATNEILGDFIHNVTVIDGGNQV
NSIPEKALLQGNIRSISEMDNETVKQVLVKIINKLNKQENVNLELIFDYDKQPVFSDKNS
DLVHIAKSVASDIVKEEIPLLGISGTTDAAEFTKAKKEFPVIIFGPGNETPHQVNENVSI
ENYLEMVDVYKRIATEFLS
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggaacgagaaagaaaaattcaaatcttaaaagacattgtgaatattgattcgactaat
gggcatgaggaacaggttgcgaactacttacagaagttgtttgctgagtatggtattgag
tctgaaaaggtgcaatatgatgtagaccgagctagtcttgttagtgaaattggttctaat
gatggcaaagttttggcgttttcagggcatatggatgtagttgatgcgggtgatgtctcg
aagtggaagttcccaccttttgaagcagcagagcatgaagggaaaatatacggacgtggc
gcgacggatatgaaatcaggtctagcggcgatggttattgcaatgattgagcttcatgaa
gaaaaacaaaaactaaatggcaaaattagattattagcaacggttggtgaagaagtcggt
gaacttggagccgaacaactaacgcaaaaaggttacgcagatgatttagatggcttgatt
atcggcgaaccgagcggacaccggattgtttatgcgcataaaggttccattaattatacc
gttaaatccactggtaaaaatgcccatagttcgatgccggaatttggtgtgaatgcgatt
gataacttgctgctattttataatgaagtagaaaaattcgtgaaatcaattgatgctact
aacgaaatattaggcgattttattcataatgtcactgtaattgatggtggaaatcaagtc
aatagtatccctgaaaaagcgctactgcaagggaatattcgctcgatttcagaaatggat
aatgaaacagtgaaacaagtgctagtgaagatcatcaataagttaaacaaacaggaaaat
gtgaatctagaattaatatttgattatgacaaacaaccagtatttagtgataaaaattcg
gatttagtccacattgctaagagcgtagcaagcgacattgtcaaagaagaaatcccgtta
ctcggtatttccggaacaaccgatgcagcagaatttaccaaagctaagaaagagttccca
gtgattatttttggaccaggaaacgaaacccctcaccaagtaaacgaaaatgtttctata
gagaattatttggagatggtagatgtttacaaacgaattgccaccgagtttttatcgtga

DBGET integrated database retrieval system