KEGG   Listeria monocytogenes HCC23: LMHCC_2370Help
Entry
LMHCC_2370        CDS       T00801                                 

Definition
beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lmh  Listeria monocytogenes HCC23
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:lmh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMHCC_2370
Enzymes [BR:lmh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LMHCC_2370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2343868..2345328)
Genome map
AA seq 486 aa AA seqDB search
MTEVKKQFPKGFLWGGATAANQVEGAYDVDGKGLSTADMVKFIPKEERTKDLELDVSKAE
IEAIIAGKVEGRFPKRDGVDFYHHYKEDIALFAEMGFKTFRLSLNWARIFPNGDDKEPNE
KGLEFYDKVFDELLKYDIEPLVTLSHYETPLNLTLKYNGWADRRVIGFFTNYAETVFKRY
KNKVKYWLTFNEINVISLSAYTGGGVLLEDAKNPLELSYQAGHHQFVASALATKLAHEII
PGSQVGCMLARMATYPATNNPDDILKAQYENQQNLFFTDVHARGEYPSYMNRFFQENDIH
IVKEVGDDEILKAHTVDFISFSYYMSLSATASPEGDRSAGNLMGGVKNEYLESSDWGWQI
DPKGLRWTLNDLYSRYELPLFIVENGLGAYDTVEEDGKIHDDYRIDYLRKHIEQMKEAIA
DGVDLIGYTSWGPIDLVSASTSEMSKRYGFIYVDQDDWGKGTLERSRKDSFFWYKKVIET
NGEDLD
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagtgaaaaaacaatttccaaaaggatttttatggggtggagcaactgctgcg
aaccaagttgaaggcgcttacgatgtagatggtaaaggcctttccacagcagatatggtc
aaatttattccgaaagaagaacgcacgaaagaccttgaactagacgtatctaaagcagaa
atcgaagcaattatcgcagggaaagtagagggtagattccctaaacgtgatggcgttgat
ttttatcaccactataaagaagacatcgcattatttgccgaaatgggctttaaaacattc
cgactatcactaaactgggcgcgtattttcccgaacggtgatgacaaagagccgaatgaa
aaaggccttgaattttatgataaagtgtttgatgaattattaaaatatgacattgagcca
cttgtgacactttctcactatgaaacgccactaaatcttactttaaaatataacggctgg
gctgatcgtcgcgttatcggatttttcacgaactacgcggaaacagttttcaaacgttat
aaaaacaaagtaaaatattggttaacttttaacgaaatcaatgttatttcacttagcgca
tacactggtggtggcgtacttttagaagacgcgaaaaacccacttgaactttcttaccaa
gcaggacatcatcaattcgtagccagtgcacttgcaacaaaattggcgcatgaaattatt
cctggatcacaagttggttgtatgttagcgcgtatggcgacttatcctgctactaacaac
ccagatgatatcctaaaagcacaatacgaaaatcaacaaaatctatttttcacagacgtt
catgctcgcggtgaatatccaagctacatgaaccgtttcttccaagaaaacgacattcac
atcgtaaaagaagttggtgacgacgaaatcttaaaagcacataccgttgatttcatttca
ttcagctattacatgtccctatccgcaacagctagcccagaaggcgaccgctctgccggg
aacttaatgggtggcgtgaaaaacgaatacttggagtcgtccgattggggttggcaaatt
gaccctaaaggcttacgctggacactaaatgatctttatagccgctacgaattaccactt
ttcatcgtggaaaatggcttaggtgcttatgatacagtggaagaagacggcaaaatccat
gacgattaccgcattgactacctgcgcaaacacatcgaacaaatgaaagaagcaattgct
gacggcgtagatttaattggatacacaagctggggacctatcgacctagtaagtgcctcc
acaagcgaaatgtccaaacgttacggcttcatctacgtagaccaagatgactggggcaaa
ggaacattagaacgctcccgcaaagattcattcttctggtataaaaaagtaattgaaaca
aatggtgaagatttagattaa

DBGET integrated database retrieval system