KEGG   Listeria monocytogenes HCC23: LMHCC_2375Help
Entry
LMHCC_2375        CDS       T00801                                 

Definition
sucrose phosphorylase (Sucrose glucosyltransferase)(Glucosyltransferase-A) (GTF-A)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
lmh  Listeria monocytogenes HCC23
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lmh00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LMHCC_2375
Enzymes [BR:lmh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     LMHCC_2375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2353902..2355344)
Genome map
AA seq 480 aa AA seqDB search
MQIKNKAMLITYSDSLGKNMEELSKVMETYFEDAIGGIHLLPFFPSTGDRGFAPSDYTTV
DSDLGSWEMIEKLGEKYYLMFDFMINHISRESLFFQDFKKEHLNSKYKDMFIRINDFFPP
GRPNEKDLDLIYKRKDKAPFQEVEFADGETELVWNTFGEEQIDLDVTAEVTKEFIRQTIK
NMAAHGCSILRLDAFAYAIKKLDTNDFFVEPEIWDLLDEVKAEAAKYDMELLPEIHEHYS
IQMKIANHDYYIYDFALPMVMLYSLYSGRVERLAKWLEMSPMKQFTTLDTHDGIGVVDAR
DLLTDEELDYTSAELYKIGANVKKIYSSEKYNNLDIYQINSTYYSALGDDDKSYLLARVI
QCFAPGIPQIYYVGLLAGKNDIDLLEETKEGRNINRHYYTIDEIKNEVKRPVVKALCNLL
RFRNTSEAFDLEGSIEIETPSSNEIVIIRKNKTNKITATLKANLSTKTFQISENERNILI
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaattaaaaataaagctatgttaattacttattctgatagtttagggaaaaatatg
gaagaattatccaaggtgatggaaacttactttgaagatgctattggtggaattcactta
ttaccgttctttccatccactggagatcgagggtttgcgccaagtgattacacaacagta
gatagcgacctaggctcttgggagatgatcgagaaattaggcgaaaagtattatttaatg
tttgattttatgattaatcacatttctcgcgaatcactcttctttcaagattttaaaaaa
gaacatttaaactcaaagtataaagatatgtttattcgtatcaatgatttctttcctccg
ggtagaccaaatgaaaaagacttagatttaatttataagagaaaagataaggcgcctttt
caagaagttgaatttgctgatggggaaacggaattagtttggaatacttttggggaagaa
caaattgatttagatgtgacagccgaagttacaaaagaatttattcgtcaaacgataaaa
aatatggctgcacatggttgttctattttgcgtcttgatgcctttgcttatgcaattaaa
aaattagatacaaatgatttttttgtagaaccggaaatttgggatttactggatgaagtg
aaagcagaagcggccaaatatgatatggaattattaccagaaattcatgaacattattcc
atccaaatgaaaatcgcgaaccatgattattatatctatgattttgcgttacccatggtg
atgctgtactcgttatatagtggccgagtggaacgtttagctaaatggttagaaatgagt
ccgatgaagcaatttactactttagatacgcatgatggcattggcgttgtggatgcacgc
gatttattaacagatgaggaactcgattatacttcagcagaattatacaaaataggagct
aatgttaaaaagatatattcctctgaaaaatataataacctggatatttatcaaattaac
agtacctattatagtgctttgggtgacgatgacaaaagttacttgctggcgagagtaatt
caatgttttgcgccggggattccgcaaatttattatgtcggtttacttgctggcaaaaat
gatattgaccttttagaagaaacgaaagaaggtcgtaatattaatcgtcattactacaca
atagatgaaattaaaaatgaagtaaaaagaccagttgttaaagcgttgtgcaatttgctg
agatttagaaatacttctgaagcatttgatttggaaggaagtatagaaattgagacacct
agctcaaatgaaatcgttattattcgtaaaaacaaaacaaataaaattacagcgacatta
aaagcgaatttaagtactaaaacattccaaatcagcgaaaatgaaaggaatattttaatt
taa

DBGET integrated database retrieval system