KEGG   Listeria monocytogenes HCC23: LMHCC_2418Help
Entry
LMHCC_2418        CDS       T00801                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
lmh  Listeria monocytogenes HCC23
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LMHCC_2418 (folP)
Enzymes [BR:lmh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     LMHCC_2418 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2401458..2402243)
Genome map
AA seq 261 aa AA seqDB search
MVMGILNVTPDSFSDGGKYMQVEEAVNRALQMAEDGAAIIDVGGISTRPGFSEVTPEEEL
TRIIPVIKAVRTKLPDIWISVDTWRAEVAEKAILAGANMINDQWGAKKEPKIAEVAAKYN
VPICLMHNRENTQYDNFLEDVKKDLLESVAIAKAASVPDEHIILDPGFGFVKTPAQNLEV
LRRIDEIVALGYEVLLGTSRKSTIGLVLGTTPEDRMEGTGATTVYGFSKGCTITRVHDVL
PIARMVRMTDAITGKLDITKL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggtcatggggatactgaatgttacgccagactctttttcggatggcgggaaatatatg
caagtggaagaagcggtgaatcgagcgttgcaaatggcagaagacggagcggcgatcatt
gacgttggtgggatatctactcggcctggtttttcagaggtaacacctgaggaagaactt
actagaattattcctgtcattaaagctgttaggacaaaacttccggatatatggatttct
gttgatacttggcgtgccgaagtggctgaaaaagctattttagcaggagctaatatgata
aatgatcaatggggtgccaaaaaagaaccaaaaattgcggaagtagctgcgaaatataac
gtgccaatttgtttgatgcacaaccgagaaaacacgcaatacgataattttctggaagat
gtgaagaaagacttattagaaagtgttgcaattgctaaagcggcatccgtgccagatgaa
catattattcttgatccgggtttcggttttgttaagacacctgcgcagaatttagaagtg
ttacgacgcattgatgagatagtggcgcttggttacgaggttttacttggtacgagtaga
aagtcgacaattggtctcgtcttaggaactactcccgaggatagaatggaaggaactgga
gcgacaaccgtttacggattttcgaaaggttgcacaattactcgtgtacacgatgtactt
ccaattgcgcgcatggtaagaatgacagacgcgattactggcaaattagatattacaaaa
ttataa

DBGET integrated database retrieval system