KEGG   Listeria monocytogenes HCC23: LMHCC_2762Help
Entry
LMHCC_2762        CDS       T00801                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lmh  Listeria monocytogenes HCC23
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:lmh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMHCC_2762
Enzymes [BR:lmh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LMHCC_2762
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2752404..2753858)
Genome map
AA seq 484 aa AA seqDB search
MEHNKLKPFPKDFLWGSASAAYQVEGAWDEDGKGPSVWDEFVRIPGTTFKETNGDVAVDN
YHRYKEDVALMAEQGLKAYRFSVAWSRVIPHGNGEVNEAGLKFYDNLIDELLSYGIEPVV
TLYHWDIPQGLQDEYGGWESRKVVEDFTNYAALLFERFNGRVKYWVTLNEQNVFISHGYK
LAYHPPGVSDDKRMFAANHNANLANASAIAKFRELGTSGKIGPSFAYGPSYSIDANPANV
LASENSEEFNAHFWMDVYTWGEYPTATWNWLEEHGLAPEILPGDTELLKKGKPDFMGVNY
YRSMTHAFNGKDGVGSGKMNTTGEKGTSEETGVPGLYKNTNNPYLEKTNWDWDIDPTGLR
IGLRRITNRYKLPIMITENGLGEYDSLTEDHKIHDEYRIEYIRAHALAIQEAITDGVEML
GYCTWSFTDLLSWLNGYQKRYGFVYVDRDENDEKELKRYKKDSFYWYKKTIEANGANLVE
EQGK
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggaacataataagttgaaacctttcccaaaagattttctatggggatcagcttctgca
gcgtaccaagtagaaggtgcctgggatgaggatggtaaaggaccatctgtatgggatgaa
tttgttcgtattcctggaacaacattcaaagaaacaaacggagatgtagcggtggataat
taccatcgttataaagaagatgtcgcactaatggctgaacagggcctaaaagcatatcgt
ttctctgtcgcatggagtcgagttatcccgcatggtaacggggaagttaacgaagcagga
cttaaattctatgataatttgattgatgaacttctttcttatggaattgagccagtcgtt
acactttaccactgggatattccgcaagggcttcaagacgaatatggtggatgggagtcg
cgcaaagtcgtagaagatttcactaactacgctgcccttctattcgaacgctttaacggc
cgagttaaatattgggtaacacttaatgaacaaaacgtatttatctcacacggctacaaa
ttagcgtatcacccacctggcgtttctgacgacaagcgtatgtttgcggcaaatcacaat
gcgaacttggcgaatgcttctgcaattgctaaattccgcgagctaggtacatccggaaaa
attggcccaagtttcgcttacggaccaagttactccatcgatgccaacccagcaaacgtg
ttagcttctgaaaactctgaagaattcaatgcccatttctggatggatgtttacacatgg
ggtgaatatccgactgctacttggaactggctggaagagcacggtcttgcaccggaaatc
ttaccaggcgatacggaacttctaaaaaaaggaaaacctgatttcatgggagttaactat
taccgctcaatgactcatgcatttaatgggaaagacggcgttggttctgggaaaatgaat
acaactggtgaaaaaggcacttccgaggaaactggtgtaccggggttatacaaaaacacc
aacaacccatacttagagaaaacgaattgggactgggacattgatccaactggcttgcgc
attggcttacgtagaattactaaccgctataaattaccaatcatgattacagaaaatggt
cttggtgagtatgatagcttgacggaagaccataaaatccatgatgagtaccgaattgaa
tacattcgtgcgcatgctctagcaatccaagaagcaatcacggacggcgtagagatgctc
ggttactgcacttggagcttcacagatttactaagctggttaaacggctaccaaaaacgt
tacggtttcgtatatgtggaccgcgacgaaaacgatgaaaaagaattaaaacgctataaa
aaagatagtttttactggtataaaaagaccatcgaagcaaacggagctaatttagtagaa
gaacagggcaaataa

DBGET integrated database retrieval system