KEGG   Listeria monocytogenes HCC23: LMHCC_2936Help
Entry
LMHCC_2936        CDS       T00801                                 

Gene name
truA
Definition
tRNA pseudouridine synthase A
Orthology
K06173  
tRNA pseudouridine38-40 synthase [EC:5.4.99.12]
Organism
lmh  Listeria monocytogenes HCC23
Brite
Enzymes [BR:lmh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.12  tRNA pseudouridine38-40 synthase
     LMHCC_2936 (truA)
Transfer RNA biogenesis [BR:lmh03016]
 Eukaryotic Type
  tRNA modification factors
   Psudouridine synthases
    LMHCC_2936 (truA)
 Prokaryotic Type
    LMHCC_2936 (truA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2921258..2922004
Genome map
AA seq 248 aa AA seqDB search
MTRYKAIISYDGSGFYGYQVQPNTRTVQAEIEKALTKMHKGKTVRITASGRTDTGVHAKG
QVIHFDSELDITAEKFQKALQVMTPFDISFLTVEEVPDDFHARFGTVGKEYRYVVKRTKI
FDPFSRDFALHYPYELDISKMKLASKRLIGEHDFTSFCSARTERDSKVRTLYSIDFYEED
DETLVIAFQGNGFLYNMVRILTGTLLDAGQGRISPDDISKALLARDRQKLISKTAPPQGL
YLWRVDYE
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgacaagatataaagcaataatttcttatgatggcagcgggttttatggctatcaggtg
cagccgaatacacggacggtccaagcggaaattgaaaaagcattgacaaaaatgcataaa
ggcaaaactgtgcggattacagcatcaggaagaacagatactggtgttcatgcgaaaggt
caggttattcatttcgattcggaacttgatatcactgccgaaaaatttcaaaaagctttg
caagtcatgactccgtttgatattagctttttaaccgtggaagaagtaccggatgatttc
cacgctagatttggcacagttggaaaagaatatcgttatgtggtaaagcggacgaaaatt
tttgatccttttagtcgggattttgcgctacattatccatatgaactggatatttcaaaa
atgaagttggcgagtaaacgcctgattggcgagcatgattttactagcttctgttcggcg
agaacggagcgcgattctaaagtccggacgctttatagtattgatttttatgaagaggac
gacgagacgttagtgattgcttttcaaggcaatggctttttgtataatatggtgcgaatt
ttgactggaactctgctcgatgcagggcaaggtcgaatctctccggatgatatttcgaag
gctttattagcacgtgaccggcaaaaattaattagtaaaacagcgccgccacaagggtta
tatttatggcgagtggactacgaataa

DBGET integrated database retrieval system