KEGG   Leishmania mexicana: LMXM_01_0320Help
Entry
LMXM_01_0320      CDS       T02288                                 

Definition
putative poly(A) export protein
Orthology
K14298  
mRNA export factor
Organism
lmi  Leishmania mexicana
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:lmi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    LMXM_01_0320
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 307 aa AA seqDB search
MLMAGVASWDGTCSIWQVARNPAGAVISQPTWTTIHDSPLLTMSFSADGRVFFGGCSKTA
VMWDLNSNQKAVVASHDLPISCLDFLTLPQTMSQMLITGSWDGKLRWWDLRQQSYVREEN
LGEPVFALDAQKTVPMMAAATGRLAHVYDVQQMQKVNELKLPDVMKFNLRCITCAPQYDG
VGVGSSEGRVSFISMKDAPGCTFKAHITTEKSHYILSQTNFCVHHPTLPLLLSGGGDGNL
TVINRADRKVIKTLQCEQKVGTQAIPISAGDISADGSLVAYAHSYDWAMGKSGYRNQPTS
VHIRPLS
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgctcatggccggcgttgcctcgtgggacgggacttgctctatttggcaggttgcacgg
aaccctgctggggcggtcatatctcagccaacttggaccacaatacacgacagcccttta
cttactatgtccttctctgcggacggacgcgtctttttcggagggtgctcaaagactgcg
gttatgtgggacctgaactcaaatcagaaagctgtcgtcgcatcacatgatttgccaatt
agctgcctcgatttcctgactcttcctcagacgatgagccaaatgctcatcaccggaagc
tgggacggcaagctgcgctggtgggacctgaggcagcagagttacgtgagggaggaaaac
ctgggggagcctgtgttcgcgctcgatgcgcaaaaaacggtgccgatgatggctgccgca
acaggtcgactggctcacgtgtatgacgtgcaacaaatgcagaaggtcaacgaactcaag
ctccccgacgttatgaaattcaacctccgctgcattacatgcgctccacagtacgacggt
gtcggagtcggatcctcggaaggacgcgtctcctttatcagcatgaaggacgcgccaggg
tgcacattcaaggctcacattaccacagaaaagtcccactatattctgagtcagaccaat
ttttgtgtgcatcaccctacgttgccactcctcctgtccggtggcggcgatggtaatttg
acagttatcaaccgcgccgatcgcaaagtcatcaaaacgcttcaatgcgagcaaaaagta
ggcacgcaagctattccaatctcagctggcgacataagcgcagatggatctcttgttgcc
tatgcgcatagctatgactgggccatggggaagagtggttacagaaatcaacctacctcg
gtgcacattcgaccgctatcgtga

DBGET integrated database retrieval system