KEGG   Leishmania mexicana: LMXM_06_0860Help
Entry
LMXM_06_0860      CDS       T02288                                 

Definition
dihydrofolate reductase-thymidylate synthase
Orthology
K13998  
dihydrofolate reductase / thymidylate synthase [EC:1.5.1.3 2.1.1.45]
Organism
lmi  Leishmania mexicana
Pathway
Pyrimidine metabolism
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:lmi00240]
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lmi00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:lmi00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 520 aa AA seqDB search
MSRAAAKFKIPMPVTKADFAFPSLRAFSIVVALDKQHGIGDGESIPWRVPEDMAFFKDQT
TLLRNKKPPTDKKRNAVVMGRKTWESVPVKFRPLKGRLNVVLSSKATVEELLAPLPEEKR
AAAAQDIVVVNGGLAAALRLLARPPYCSSIETAYCVGGAQVYADAMLSPCVEKLQEVYLT
RIHTTAPACTRFFPFPPENAATAWDLASSQGRRKSAVDGLEFEICKYVPRNHEERQYLEL
IDRIMKTGIAKEDRTGVGTLSLFGAQMRFSLRDNRLPLLTTKRVFWRGVCEELLWFLRGE
TNAQLLADKDIHIWDGNGSREFLDSRGLTENTEMDLGPVYGFQWRHFGAEYRGLEANYDG
EGVDQIKFIVETIKANPNDRRLLFTAWNPCALHKMALPPCHLLAQFYVNTEKSELSCMLY
QRSCDMGLGVPFNIASYALLTILIAKATGLRPGELVHTLGDAHVYRSHIGALKAQLERVP
HAFPTLVFKEERQFLEDYELMDMEVIDYVPHPAIKMDMAV
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgtccagggcggctgcgaagttcaagattccgatgccggtgacgaaggcggacttcgcc
ttcccctccctgcgcgccttctccatcgtcgtggccctcgataagcagcacggcatcggc
gacggcgagtcgatcccgtggcgggtgccggaggacatggcgttcttcaaggaccagacg
acgctgctgcgcaacaagaagccgccgacggacaagaagcgcaacgccgtcgtgatgggg
cgcaagacgtgggagagcgttccggtaaagttccggccactcaagggccggctgaacgtt
gtgttgtcctcgaaggccaccgtcgaggagcttctggcgccactgccggaggaaaagcgc
gcggcggcggcgcaggacattgtggtggtgaacggcggtctggccgcggcgctccgcctc
ctcgcacgtccgccgtactgcagctccatcgagacggcgtactgcgtcggcggtgcgcag
gtgtatgcggacgccatgctgtcgccatgcgtcgagaagctgcaggaggtgtacctgacc
cgcatccacacgacggcgcctgcgtgcacgcgcttcttcccgtttcctcccgagaacgcc
gccacggcgtgggacctggcgtcgtctcagggacgccgcaagagcgcggtggacggcctc
gagttcgagatttgcaagtacgtgccgcgcaaccacgaggagcggcagtaccttgagctg
attgaccgcatcatgaagacggggatcgcgaaggaggaccgcaccggggtgggcaccttg
agcctcttcggcgcacagatgcggttctccctacgcgacaaccgcctgccactgctgacg
acgaagcgcgtcttctggcgaggcgtgtgcgaggagttgctgtggttcctgcgcggggag
acaaacgcgcagctgctcgcggacaaggacatacacatctgggacggcaacggctcgcgc
gagtttctcgacagccgcggcttgacagagaatacggagatggacctcggccctgtctac
ggcttccagtggcgccacttcggggcagaataccgggggctcgaagcgaactacgacggc
gagggggtggaccagatcaagttcatcgtggagacgatcaaggcgaacccgaacgaccgc
cgtcttctgttcactgcgtggaacccgtgcgcgctgcacaagatggcactgccgccgtgc
cacttgctcgctcaattctacgtgaacacggagaagagcgagctatcctgcatgctgtac
caacgttcgtgcgacatgggcctcggcgtccccttcaacatcgcctcctacgcgctgctc
accatcctcattgccaaggcgacgggtctgcggcctggtgagcttgtgcacaccctcggc
gacgcccacgtctaccgcagtcacatcggtgccctcaaggcgcagctcgagcgagtcccg
cacgcgttcccgaccctcgtgttcaaggaggagcggcagttcctcgaggactacgagttg
atggacatggaggtgatcgactacgtgccgcacccggcgatcaagatggatatggccgta
tag

DBGET integrated database retrieval system