KEGG   Leishmania mexicana: LMXM_07_0730Help
Entry
LMXM_07_0730      CDS       T02288                                 

Definition
malonyl-coa decarboxylase-like protein
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
lmi  Leishmania mexicana
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:lmi00640]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:lmi00410]
Cellular Processes; Transport and catabolism; Peroxisome [PATH:lmi04146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 794 aa AA seqDB search
MRCGYRCVCGARDSAAATASCGTIHSAGTVAYALRHFSAPTRLWRSEPLPPPLPPLPGPG
ATVSEERVARWCRRLWDLTRKPTGSAASDHLTPPPQLTAHRAAAALLSSSSSSPFTAPPQ
IDDRGQVAGEVVLSCLRRAIRSDQGRIPGVIVESVWAAFDVLVPPIVQDSVTEDSITPAT
EDSFFMFISTLNELNFDLHAVVKASTQLTAKVDAYVALLRQAEAQEAQRAATAAACGPAQ
ATIDGCEVMEKLMKTKGEVMQCCFEARNAGSPLYYTWLWHTAAMPDGLRRLMHFRKLTHF
FESLCKRHIKHLTQQQQQGSSLSSSAPATGEAAGTLPSAATAAASTTERSCCAGELSKWR
SRLVEVGLIDGAMSLLLHDLFSKEYLVMEELTWLSTPPSMLDQIMRAESVHPFVCGLEDM
RHRLQPAHHRHLFAFLHPAVVEEPLIAVQVALTHGIASSVDQILGRPTPLSDPANTSKAA
LYFRHTLASSAAVDCAGAVEDGNVNTAIFYSINSAQSALRGMDMGNRLIKRVVQEVEGNI
NARRQARSLTPIHTFSTLSPIPLYVTWLADEVTALAAAAATATTMTASGIFGKQLSTTEE
DARYLGPLREAIADYALRHPDILPAEARAVMSAVAARRGRGNHATANIAALQYLVRLLQD
ASSAPSLPHDGPTTLAAGSASTERHQQPWWMDHTFTMALETPLLRSVATYLCTAKRGGDG
RIRDPVGNFHVSNGATVYRLNFLANTTPKASRESACIMVNYWYDLPAVSANAAQYEVSRT
VPLGEPIKTLLEDR
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atgcggtgtggctatcggtgtgtttgcggtgcgcgtgattcagcagcagccactgctagc
tgcggcactatccattccgccggcaccgtggcgtacgccttgcggcacttcagtgcgcct
acgcgtctgtggcggtcggagccactgccaccgccactcccgccactgccggggccaggc
gccacggtgagcgaggaacgtgtcgcgcgatggtgtcggcggctctgggacctcacgcgc
aagcccactggcagcgcggcctctgaccatctcaccccaccgcctcaactcaccgcccac
agagcagcagcagcattgctatcgtcgtcgtcgtcgtcccccttcaccgcgccaccgcag
attgacgaccgtgggcaggtggcgggcgaggtggtgctgtcctgcctgcgccgtgccatc
cgtagcgatcaaggccgcattcctggcgtcattgtggagagcgtgtgggccgccttcgac
gtgctcgtgccgcccatcgtccaggacagcgtcacagaggacagcatcacacccgcgacg
gaggatagcttttttatgtttatctcgaccttgaacgaactcaacttcgacctgcacgcg
gttgtgaaggcaagcacgcagctgacggcgaaggtggacgcctacgtggccctgctgcgg
caggcagaggctcaagaagcgcagcgagcggcaacagcagcggcctgtggtcctgcacag
gccactatcgacggatgcgaagtcatggagaagctcatgaagactaagggggaggtcatg
cagtgctgcttcgaggcccgcaacgccggctctcctctctactacacctggttgtggcac
acggccgccatgcccgacggcctgcggcggctcatgcacttccgaaagctgacccacttc
ttcgagagcttgtgcaaacggcacatcaaacacctcacgcagcagcagcagcaggggagc
tctctgtcttcttcggcgcctgctactggtgaggctgcggggacgttgccttcagcagca
acagctgcagcaagcaccacggagcgaagttgctgcgccggcgagctctccaagtggcgt
agtcgtctcgtcgaggtcggcctaatcgatggtgccatgtcgcttctcttacacgacctg
ttctccaaagagtacttggtgatggaggagctgacgtggctctcgacgccgccgtcgatg
ctggaccagatcatgcgtgccgagtctgtccatcccttcgtctgcggactcgaagacatg
cgccatcgcctgcagccggctcaccaccgtcacttgttcgcctttctgcaccccgctgtt
gtcgaggagccgctcatcgccgtgcaggtggccttgacgcacggcattgccagctcggtg
gaccagatcttgggtcgccctacaccgctgtcagacccggcgaacacgtcgaaggcggcc
ctctacttccgccacacactggcatcctcggcggcggttgactgcgccggtgcggtggaa
gatggcaacgtgaacaccgccatcttctatagcatcaactctgcccagagtgcgttgcgc
ggcatggacatgggcaaccgcctcatcaagcgcgtcgtgcaggaggtggagggcaacatt
aacgcccggcggcaggcgcgcagcttgactcccatccacaccttcagcaccctctcaccc
atcccgctctacgtcacgtggctggctgatgaggtgactgcgctggcggccgccgctgcg
acagccaccacgatgacggcgagcggcatctttgggaagcagctctccacaaccgaagaa
gatgcacgttacttggggccgcttcgcgaggcgattgccgactacgccctgcggcacccc
gatattctaccggcggaggcgcgggcggtgatgtcagcggtggccgcaaggcgtggtcgc
ggcaaccacgcgaccgccaacatagcggcactgcagtacctcgtgcgtctcctccaagac
gcatcttcggccccctcattgccacacgatggtcctaccacgctcgccgcgggcagtgcc
tcgacagagcgacatcagcagccatggtggatggaccatacgttcacgatggccctcgag
acgcccttgttgcgttccgttgccacgtacctgtgcactgccaagcgtggtggtgacggc
cgcattcgtgacccagtcggcaactttcacgtgtctaacggcgccactgtttatcggcta
aacttcctcgcgaacacgaccccgaaggccagccgcgagagcgcctgcatcatggtaaac
tactggtacgacctgccagcggtctcagccaacgccgcgcagtacgaggtgagccgcacc
gtgcccctcggtgagccgatcaagacactgctggaggacaggtag

DBGET integrated database retrieval system