KEGG   Leishmania mexicana: LMXM_08_29_2020Help
Entry
LMXM_08_29_2020   CDS       T02288                                 

Definition
putative protein kinase
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
lmi  Leishmania mexicana
Pathway
Regulation of autophagy
Brite
KEGG Orthology (KO) [BR:lmi00001]
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    LMXM_08_29_2020
Enzymes [BR:lmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     LMXM_08_29_2020
Protein kinases [BR:lmi01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   LMXM_08_29_2020
Mitochondrial biogenesis [BR:lmi03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    LMXM_08_29_2020
  Mitophagy factors
   Other mitophagy factors
    LMXM_08_29_2020
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 815 aa AA seqDB search
MAQAAYPPSREGSYPHSRSGGPHANPMLPEQMIGSYVIRETIGRGSFGKVKKGRHVHTGE
YVAIKILNRQKLKSANMDKKIHREIEILQLFSHPNICRLYEVISTPTDMYLIMEYVEGGE
LYDYIVQKGRVRESEARYIFQQIVCAIEYCHHFRVVHRDLKPENILLGTGLQVKLIDFGL
SNITKDGEFLATSCGSPNYAAPEVISGKLYFGPEVDVWSCGVILYALLCGCLPFDEDSIP
LLFSKIKKGKYTIPSNMQTGPRELIQQILVVDPLVRLTVPQIRDNAWFNQRLPMRLSYSE
SIFSVKEDRILSVLVSETAKRLGVRDRDVRKELELGYGVAFVAYNILLDARRRREIAAEV
RELGMSGDESRGVNHVIGAQQTKFQPKATERELNMGLMLTQSPAMVVLLDEEDATRNKWA
YNRGYFVPASVATLGDPTKVSDASLSDGSGNGGPGGSVAVGSFRITSKMCSGSLVGSGSV
GSSSYAPGSLRGAAGPTGGSSSYRRAGMQSSTGGTAASQLGANLSDQPRVGSVARKHAMY
TAEEEQFIVENNYGWRIGIMTDWRAEQALSAIYDVLRTFEMQWKVVSPFRLLARSTAETW
SVVADSTKSPNASTRRNTLSTYSAESSAPIRIGCSSGAAGSGSSDDHEDGDIAGSTQRDE
ECIHSHIARTRRPGAAARSVGSAPGGGFSTSTSQAARGNYFGGLQDGDEEAAMVSGSAAS
GVLPPAHVMESGSESTFSLRDRRGASLPGSAAVSTSAVAERASPPANPVVLSLYFFRIHE
RHDKGYLVDFKVVRNAMVAADLVLLLSDALVRKLG
NT seq 2448 nt NT seq  +upstreamnt  +downstreamnt
atggcacaggccgcgtacccaccgtcgagagagggcagctacccacactctcgtagcggt
ggtccccacgcgaacccgatgctgcccgagcagatgatcggcagctacgtcattcgcgag
accatcggccgcggtagctttggcaaggtgaagaaggggcgacacgtgcacactggagag
tatgtcgccatcaagatcctcaaccgccaaaaactcaagtccgcgaacatggacaagaag
atccaccgcgagatcgaaattctgcagctgttctctcacccgaacatctgccgtctctat
gaggtcatttctacccctacggatatgtaccttattatggagtacgtggaaggcggagag
ctgtacgactacattgtccagaagggccgcgtgcgggaaagtgaggcgcgttacatcttc
cagcagattgtgtgcgcgatcgaatactgccaccacttccgcgtcgtgcatcgtgacctg
aagccagagaacattctgctgggaactgggctgcaggtaaagctgattgactttggtctt
tcgaacatcacgaaggatggcgagttcctcgcgacgtcgtgcgggtcgcccaactacgcc
gcaccggaggtcatttcaggtaaactgtactttggcccagaggtggatgtatggtcttgt
ggcgtcattctctacgcactgctctgcgggtgcctgccgttcgacgaggatagcatcccg
ctccttttcagcaagatcaagaaaggcaagtacaccatcccatccaacatgcagacgggg
ccgcgggagctcattcagcagatcctcgtcgtggatccactcgtgcggctgaccgtcccg
cagatccgcgacaacgcctggttcaatcagcgcctgccaatgcggttgtcgtacagtgag
tccatcttcagcgtgaaggaagaccgcattttatcggtgctggtgagcgaaaccgcgaag
cgactgggggtgcgggacagagatgtgcgcaaggagctcgagcttggctacggggtcgcc
tttgtcgcctataatattctgttggacgcacgccgccgtcgcgagattgcggcggaagtg
cgcgagcttggcatgtccggcgatgagtcccgcggggtgaaccacgtcatcggcgcacag
cagacgaagtttcagcccaaggcgacggagcgggaactcaacatgggcctcatgctgacg
cagagccccgcgatggtggtgctgctcgacgaagaagacgccacgaggaacaagtgggcc
tacaaccgcggctacttcgtgcccgcttccgtcgcaacccttggcgacccaacaaaggtg
agcgatgcgagcctcagtgatggcagcggcaatggtggtccaggcgggtcggtcgcagtc
ggctccttccgtatcacttccaagatgtgttccggatctctggttggctccggcagtgta
ggctcttcctcgtatgcgccaggcagtctgcgcggcgcggctgggcccacgggcggcagc
agcagctaccgacgtgctggcatgcagagcagcactggtggaaccgccgcttcgcagcta
ggggcgaacctcagcgaccagccgcgcgtcggatctgtagcccgcaagcacgccatgtac
accgcggaggaggagcagtttattgtggagaacaactacggctggcgcatcggtatcatg
acggactggcgggcagagcaggcgctttccgccatctatgacgtcctgcgcaccttcgaa
atgcagtggaaggtggtctcgcccttccgcctcttggcacggtcaacggccgagacatgg
agtgtggtggcggactcgacgaaaagtcccaacgcgtccacgcgccgaaacacgctaagc
acctactccgctgaatcctctgcaccgatccgcattggctgcagcagcggtgccgcaggg
agcggcagcagtgacgatcacgaggacggagacatcgctggtagcacgcaacgcgacgag
gagtgcatccactcacacatagcccgcacacgccggccaggcgctgcggctcgcagcgtc
gggagtgcaccaggtggtggcttcagcactagcacgagccaggccgcgcgcggcaactat
ttcggcggcctacaggacggagacgaggaagcggcgatggtctctggaagcgcagcgtcg
ggagtgctgccgccggcgcatgtgatggagagcgggtctgagtcgacgttctcgctgcgt
gaccgacgcggcgcgtccctaccagggagcgccgctgtttctacctccgcagttgcggaa
cgagcctcaccgccggcaaaccctgtcgttctttccctctacttctttcgcattcacgag
cggcacgataaaggttacctggtggatttcaaggtcgtgcgcaatgccatggtcgccgcg
gacctggtgcttcttctctctgatgcgctggtcaggaagttgggctga

DBGET integrated database retrieval system