KEGG   Leishmania mexicana: LMXM_08_29_2300Help
Entry
LMXM_08_29_2300   CDS       T02288                                 

Definition
cysteine peptidase, Clan CA, family C19,putative
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
lmi  Leishmania mexicana
Brite
Enzymes [BR:lmi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     LMXM_08_29_2300
Peptidases [BR:lmi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   LMXM_08_29_2300
Exosome [BR:lmi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   LMXM_08_29_2300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 748 aa AA seqDB search
MPFPVTQEACPHAWSDSAIVTPFPGKTVHRDECAYCCRTCRQGDGVYVCMACHTGLCCEH
LEKHMGVHGAHAMYTTVKKLPAKEMEEVKDVNYLGVVAPAEYETAVCCADCQVQFAQIPD
LAVEAYSGIINAPEPGAQDSTADGGVGRLQKPQCPHLVCLEQLASPFAVCPPTSDDICSV
EMCGCHVNNWMCVTCGAIGCPRPEAGGQGHALQHYELTGHPACVKLGTITAQGADYYCYA
CDDDVDDVHFEAHMAHFGIDVQTAKKTAKTMGELEYDYSSQFDFNKITEAGVSLTPSYGP
GHTGIENIGNSCYIASVVQCLMSLGPFQHSFFPAKSSPHQAQCSANPYNCHHCQTERVAA
GLLSGEFSREGHELTNGICPRLFKKVYAHQHPEFSTGAQQDAQEYLLYLLTEMQRHVHLN
SSGSTSAGNVQQQIHPSDIMEMVIEQRMQCSKCQRVRYTYETDKCLSLPIPIDPVSASSV
AAAASEEEMNAIRPRCSLEACLQAATSPSGIECRCEACLESAVYYTVTRLASFPDVLPVY
IRRTYFDMTTRSTKKMDAYVEVPQELVLEAYRGTGLQPGEVLMPASSASPARQPRVDAHA
PAPPQEVDEVALVSVVSMGIEMDVARYALLQTNMNVELAIDYIFSHPHIADEIKAAPPLH
AEEQKQYLAPTHNATSVSAPKPATDGAASYELTAMISHMGASARTGHYVCHIKDAATGKW
LLFNDEKVGESQNPPFSLASLYFFQRKA
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgccgttccctgtgacgcaggaggcgtgtcctcatgcgtggagtgactctgccatagtg
accccgttccccggaaagacagtgcaccgcgacgagtgcgcgtactgctgccgcacgtgc
cgtcaaggcgacggggtctatgtatgtatggcatgccacacgggtctgtgctgtgagcac
ctggagaaacacatgggggtgcacggggcgcacgccatgtacacaaccgtcaagaagctc
cctgcaaaggaaatggaggaggtgaaggatgtgaattaccttggtgtagtggcccccgcg
gagtatgagacggccgtgtgctgcgcggattgccaggttcagtttgcgcaaataccggac
ctggctgtggaggcgtacagcggcatcatcaacgcaccggagccaggcgcgcaggatagc
acagctgatggcggtgtgggccggctgcagaagccgcagtgccctcacctggtgtgcctc
gaacagctggcgagccctttcgctgtttgtccaccgacttccgacgacatctgctccgtg
gagatgtgcggatgccacgtgaacaactggatgtgcgtcacgtgcggtgcaatcggttgc
cctcgtcccgaggcaggcggccagggtcatgcactacagcactatgagctgacaggacac
ccggcgtgtgtcaagcttgggaccatcaccgcgcagggcgccgactattattgctacgcc
tgcgacgatgacgttgatgacgtacacttcgaagcccacatggcacacttcggcattgac
gtacaaactgccaagaagaccgccaagacgatgggcgagctcgagtacgactactcctcg
cagtttgacttcaacaagatcacggaggccggcgtgtccttgacgccatcctacggccca
ggccacactggcatcgagaatatcggcaacagctgctacatcgcatccgttgtgcagtgc
cttatgtcgctgggcccgttccagcactccttctttccggccaagtcatccccgcatcag
gcgcagtgcagcgcgaatccgtacaactgccaccactgccaaacagagcgcgtggcagcc
ggcttgctctccggtgagttcagccgcgaaggtcacgagctcaccaacggcatttgcccc
cgcctcttcaagaaggtgtacgcccaccagcaccctgagttctccaccggcgcccagcag
gatgctcaggagtacctgctttacctactgacagagatgcagcggcacgtgcacctcaac
agcagcgggagcaccagtgccggcaatgtgcagcagcagattcacccgtctgatatcatg
gagatggtgattgagcagcgtatgcagtgcagcaagtgccagcgagtgcgttacacgtac
gagacggacaaatgcctatccttgccgatcccgattgatccagtgtcggcctcgtctgtt
gcggctgctgcaagcgaggaggagatgaacgcgatacggccccggtgctcgctggaggcc
tgcctgcaagcagccacctcgccgagcggcatcgagtgccggtgcgaggcatgccttgaa
tcggccgtgtactacaccgtcacccgtctcgccagctttccagatgttctgccagtgtac
attcgccgcacgtacttcgacatgactacccgcagcacaaagaaaatggatgcatatgtg
gaggtaccgcaagagctcgttctggaggcttaccgcgggactgggctgcagccgggtgag
gtgctgatgcctgcttcgtcagcctcccctgcacgacaacctagggtagatgcccacgct
cccgctccgccgcaggaagtagatgaggtggcactggtatcggtggttagcatggggatc
gagatggacgtcgcgcgctacgccctcttacagacgaacatgaacgttgagctcgccatt
gactacatattcagccatccgcatatcgccgacgagatcaaggccgcgccaccgttacac
gccgaggagcagaagcagtatttggccccaacccacaacgctacttcagtgagcgctccg
aaaccggctaccgatggggccgcttcatacgagctcacagcgatgatcagccacatgggc
gcgagtgcgcggacggggcattacgtttgccacattaaggatgccgcgacgggcaagtgg
ctcctgttcaatgatgaaaaggtaggtgagtcgcagaacccgcccttctccctggcgtcg
ctgtactttttccaacgcaaggcgtaa

DBGET integrated database retrieval system