KEGG   Leishmania mexicana: LMXM_09_0240Help
Entry
LMXM_09_0240      CDS       T02288                                 

Definition
cysteine peptidase, Clan CA, family C19,putative
Orthology
K11848  
ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.1.2.15]
Organism
lmi  Leishmania mexicana
Brite
Enzymes [BR:lmi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     LMXM_09_0240
Peptidases [BR:lmi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   LMXM_09_0240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 949 aa AA seqDB search
MRLRLLPRCRRVTTSYLLPIMSATTASSRRKQHRESLKEESMISFEMELDEAIELPFDVS
PVAPTDSAPSPPFGRKKIAMPASRTASEKRVAWSNGSTASLGLAVCGNVNELPNTAATAD
GVTSPDVVPPNAAAKTYSAAAPSRMVTWKDTSASQRRAEAQASRQDDFNPMILCPLQNLG
NTCYFNAGVQLLVNCPALVYAVRNSPFARRAQSNIPLTAHAVPMPPAAAPTATTKLCLKG
GAATHALFQEFSALLARMEMGCAAGERAISPMCALDSLAQAYPQFEGRSQQDAAEMMTSL
LASLEEEGGQYVEVTQLLHSFEEDAAALRQGVTSSASSPVGPELMGRVRTSATSSLLEAE
AAPSASSHRRDYSEPYNIEEYSQPSLLSSTSEDTFLPGPRSAHFFAVLRLMERVNRDNEL
LERRVKQRQGVAYTSPFKPPRLHFNPLLDGFRGYTLSEVECHNCRAVSRVVSAFNGLLLD
VPTAKQRRRYALAHPNVLRRVDFDGELRQVKKPFRMTWWNPLSLCVAAWRQLKRFFQDPF
PYPLWLDECLDIHFEPEVLRGCNKYRCESCDTTTDATKSETLLALPEYLLIHMKRFEAGR
FFNSKKSDSVFFPTSWRPLTNTQARQSPINTDDAPPALPEYLDLRHYLHSSVASFAEPTP
PCLWSADNEPHQQRRASRDDASSPTSSIPTTYTLDGIVNHHGGYDGGHYTVFLYKATEER
QAWVYISDDEVDQAEEVVATDTEYVLLYRRQPLVQAAPESDDGEQLRRKACYYLSLSSPS
CPAANTAAATTAGPHAKKLHSRCPFSSSSADGAASAPPDAATAATEPRVYISRMWLQRVA
FMHEPGPIVNRLCYCRPEDQGRVSMYRTIFPATVKVPAEVPHVHGPPVSWFYVPITQKDY
DIFYNAFGGNAAVTASEYESLRAMQDKFCAAIDLAERQRGRSARPAPRS
NT seq 2850 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctgcgcctgctgccacggtgtcgccgagtcaccacatcttacctgctgcccatc
atgtccgccacaacagcgtcgtcgcggcggaaacagcaccgcgagtcgctcaaggaggag
tcgatgatctcgttcgagatggagctcgacgaggcgattgagctgccgttcgacgtgagc
cccgtcgcgccgacagactcggcgccgagcccgccgtttgggagaaagaaaattgcaatg
cctgcttcacggaccgcttcggagaagagggtggcatggagcaacggcagcaccgccagc
ctcggactcgccgtgtgcggcaacgttaatgagctcccaaacaccgccgcgaccgccgac
ggcgtcacctctcccgacgtcgtgccacccaatgcagctgccaaaacctactcggcagcg
gcgccgtcacgtatggtgacgtggaaggacaccagcgcgtctcagcggcgtgccgaggcg
caggcgagccgccaagacgacttcaaccccatgattctgtgcccgctgcagaacctgggc
aatacgtgctacttcaacgcgggtgtgcaactgctcgtgaactgccccgccctcgtctat
gcagtgcgcaactcgccgtttgcgcggagggcacagagcaacatccccctcaccgcccac
gccgtaccgatgccgccggctgcagcgccaactgcaacgacgaagctgtgtctgaaaggg
ggtgccgccacccacgcactcttccaggagttctccgccctgctcgcccgcatggaaatg
ggatgtgcagccggtgagagggcgatctcgcccatgtgcgcgctcgactccctcgcgcag
gcgtatccgcagttcgagggtcgaagccagcaagatgcagcagagatgatgacgtcgctg
ctcgccagcttggaggaggagggcggtcagtacgtggaggtgacacagctgctacactcg
tttgaagaggatgccgcggcgctgcggcagggcgtgacgtcctcggcttcctctcccgtg
gggccggagctaatggggcgggttcgcacgagtgccacctcgtctctcttggaagccgag
gccgcgccctccgcatcgtcgcatcgccgtgattacagcgagccctacaacatcgaggag
tactcccagccatcgctgctctcctccaccagtgaggacaccttcctgccgggtccgcgc
agcgcgcacttcttcgccgtactgcggctgatggaacgagtgaatcgggacaacgaacta
cttgagcggcgtgtgaagcagcggcaaggagttgcctacaccagccccttcaagcccccg
cggctgcacttcaacccgctgctggacggcttccgcgggtatacgctgtcggaggtggag
tgccataactgccgcgcggtatcgcgcgtggtgagcgccttcaatgggttgctgctggat
gtgccgacggcaaaacagcgccggcgctacgcgttggcgcacccgaatgtgctgcgccgc
gtcgacttcgatggggagctgcggcaggtgaagaagccgtttcggatgacctggtggaac
cccctctccctgtgcgtggcggcgtggaggcagctgaagcggtttttccaggacccgttc
ccgtacccgctgtggctggacgagtgtctcgacattcacttcgagccggaggtgctgcgc
gggtgtaacaagtaccgctgcgagtcctgcgacaccaccaccgacgccaccaagtcggag
acgcttcttgccctgcccgagtacctgctcattcacatgaagcgcttcgaggccggccgc
ttcttcaacagcaaaaagtcggactccgtcttctttcccacctcgtggcggccgctcacg
aacacgcaggcgaggcagtcacccatcaacacggacgacgcgccgccagcgctgccagag
tacctcgacctacgccactacctgcacagcagcgtcgcatccttcgcagagccgaccccg
ccctgtctgtggagtgccgacaacgagccccaccagcagcgtcgcgcgagcagggacgat
gccagcagccccaccagctccatcccaaccacctacacgctagacggcattgtcaaccac
cacggcggctacgacggcggccattacaccgtcttcctctacaaggcgacggaggagcgg
caggcgtgggtgtacatcagtgacgatgaggtggatcaagcggaggaggtagtggcaacg
gataccgagtacgtcctgctgtaccgccgccaacccctcgtgcaggcggcgccagagtcg
gacgatggagaacagctgcgccgaaaggcgtgctactacctctctctgtcatccccttcc
tgccctgccgccaacaccgcggcagcgacgaccgccggtcctcatgccaagaagcttcat
agcaggtgccccttctcgtcctcttcggcagacggcgcggctagtgcgccacctgacgcg
gcaaccgcggcgaccgagccgcgggtgtacatctcgcgcatgtggcttcagcgcgtcgcc
ttcatgcacgagccgggcccgattgtgaatcgcctgtgctactgccgtccagaggatcag
gggcgggtgagcatgtatcggaccatctttccagccacagtgaaggtgccggcggaggtg
ccccacgtccacggcccgccggtgagctggttctacgtgcccatcactcagaaggactac
gacattttttacaacgcgtttggcggtaacgcagccgtgacggcgagcgaatacgagtcc
ctgcgtgccatgcaggacaagttctgcgccgccattgatttagcggagcggcagcgaggc
cgctccgctcgccctgctccccggagctga

  All links  
No link information was found.   
DBGET integrated database retrieval system