KEGG   Leishmania mexicana: LMXM_10_0490Help
Entry
LMXM_10_0490      CDS       T02288                                 

Definition
(RefSeq) putative map kinase 3
Organism
lmi  Leishmania mexicana
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
10
AA seq 388 aa AA seqDB search
MHKSNQELSVPKVVGDFKVYNVSGSPFEVPSKYTLLKILGMGAYGIACSCLDGDTGEKVS
IKKCRDVFRDVEDGKRVLREIDMMRFFHHENLLNVVNILPPLKCEYHSFEDVYVVTPLMD
VDMNVVLRSRQVLEESHMQYFVYQILRGLKYLHSANVAHRDLKPANLVTNISCELKIIDF
GLSRSVDVPYSELTDYVITRWYRPPELLLENTNYSTAVDIWSVGCIFAEMYNRKPVFPGR
NTMDQLRMIAQHIGKPPASIVEHREALEKLNELPGGSLNIPKLVPGLAGNTEGIDFLSKM
WTLDPSKRPTAADMLAHPYLAHLHDEEDEPACPCPFLWAHESTPMGVSELRRAFWADIVD
YNPSLEHATPPATTAGGSSSKNGSGHHH
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgcacaagagcaaccaggagctgagcgtgcccaaggttgtgggggacttcaaggtgtac
aacgtaagcggctccccattcgaggttccgtccaagtacacgctgctcaagatccttggc
atgggtgcctacggtatcgcgtgcagctgcttggatggcgacactggcgagaaggtgtcc
atcaagaagtgtcgcgacgtgttccgcgatgtcgaggatggcaagcgagtgctgcgcgag
atcgacatgatgcgcttcttccaccacgaaaacctgctcaatgtggtgaacattttgcct
ccgctgaagtgcgaataccacagcttcgaagacgtgtacgtcgtcactccgctcatggac
gtagacatgaatgtcgtactgcgctctcgacaggtgctggaggagtcgcacatgcagtac
tttgtctaccagattctgcggggcctcaagtacctgcacagcgcgaacgtcgcccaccga
gacttgaagccagccaaccttgtcacaaacatctcttgtgagctcaagattatagacttc
gggctgagccgcagcgtcgatgtgccgtactcggagcttacggattacgtcatcacgcgc
tggtaccgcccgccggagctgcttctggagaacacgaactattccaccgcagtcgacata
tggtctgttggctgcatctttgctgagatgtacaaccgtaagcccgttttcccaggtcga
aatacgatggaccagctgcgcatgatcgcgcagcacattggcaagccgccggccagcatc
gtcgagcaccgcgaggcgctggagaagctgaatgagctgccgggcgggtcgctcaacatt
cctaaactcgtccccgggctggctggcaacacggagggcatagactttctctccaagatg
tggacgctagacccgagcaagcgtccgaccgcggctgacatgctcgcgcacccatacctg
gcccacctgcacgacgaggaagatgagccggcctgcccctgccccttcctgtgggcacat
gagagcaccccgatgggcgtctcggagcttcgtcgcgccttctgggccgacattgtcgac
tacaacccgtctctggagcacgccacgcctccagcgacaacggctggtggcagcagctca
aagaacggtagcggtcaccatcactag

DBGET integrated database retrieval system