KEGG   Leishmania mexicana: LMXM_11_0450Help
Entry
LMXM_11_0450      CDS       T02288                                 

Definition
putative DNA ligase
Orthology
K01971  
DNA ligase (ATP) [EC:6.5.1.1]
Organism
lmi  Leishmania mexicana
Pathway
Base excision repair
Nucleotide excision repair
Mismatch repair
Non-homologous end-joining
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:lmi03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:lmi03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:lmi03430]
Genetic Information Processing; Replication and repair; Non-homologous end-joining [PATH:lmi03450]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 746 aa AA seqDB search
MALSTLDILEHRLQAAGLGGTTSTAPTPKSRAAPSATGNYSAADKADQLKWFSSSVDAPF
FISPKHDGVRLISYVPPTSPTEPPSPQQASSTTKKTGATTGESPPLMTCYSRYGRPIYGL
FWIEEELRLLRALCGDASLIIDGELYLHQTDMDAPRASRGGRPDAPDGRKKNPARRALPS
SDADGANNFNTGFLAVSALVNRCRSSTCQCASEEGVLKYVPSLPRFCVFDVPSYSPSANP
LAPPTRDAPTALSAASRLHIVAKASVKDDGDSQQVLAELQRVRSDVTDALRLNDVEQLRI
VPNVTPFSQRLRTMHYLFELLSRAMESPVLRQHFCPTSARMCAAPTTRSIRGCRKHTSTA
AQAQQPHSGIGQHHGGHFVSRIPYQLVKSLEDTTQRVLPVYLDAGYEGAVIRAPVNTYDF
KEKTKGTLAALVAPLLRAAETTKTRRGRHLRGTNTGAGEASGRRARNRAAMLLSLNTRPV
LGAATPLMVHAYRGNAPCCEPMQPISPSDAGLTDAELDVLDVVAVGRRAILQGAKLPLRS
MTAVKVLTYHDREYPILRPLLKEPSKNPRTRELVSIPRSHVRALGYPIKPSADTALSDDN
GATTLTPATPPGEKKATKRKNHPTTSGEGSTVFYGLQCLAENGLVFNVSLPKMTLAQQKT
LLQHLLSAGRDAMRDGREAASPTMNTHHNKKSKAKAPYGGATHAGASKIVSLTGLYATVK
FSTLTEHGLPRFGSVKAIRGGKGWFI
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atggccctcagtaccctcgacatactggagcatcgcctccaggcagctgggctgggtggc
acaaccagcaccgctcccactcccaagtcgcgtgcggcaccgagcgccaccggcaactac
agtgcggcagacaaggcggatcagctcaaatggttcagcagcagtgtcgacgccccattc
ttcatctcccccaagcacgacggtgtgcgcctcatctcgtacgtccctccaacaagtcca
acagagcccccatctccgcagcaagcatcaagcacaaccaagaagaccggtgccaccaca
ggcgagtcgccaccgttgatgacgtgctactcgcgctacggacgtcccatctacggtctc
ttctggattgaagaggagctgcgcctcctgcgggccctctgcggcgacgcctccctcatc
atcgatggggagctgtacctgcaccagaccgacatggacgccccacgagcgagccgggga
ggccggcctgacgcccctgatggtaggaagaaaaatccagctagaagggcgctgccgtct
tccgatgctgacggagccaacaacttcaatacgggctttctcgccgtctctgccctcgtc
aatagatgccgcagctccacctgccagtgcgcgagcgaggaaggtgtcctgaagtacgtc
ccctccctgcctcgcttctgcgtcttcgatgttccctcctacagcccgtccgccaatcca
ctggcaccccccacccgcgatgcgccgaccgccctctcggcagcgtcacgtcttcacatt
gtggccaaagcctccgtgaaggatgatggagactctcagcaagtcttggcagagttgcag
cgcgtccgcagcgacgttaccgatgcacttcgactcaacgatgtggagcagcttcgcatc
gttccgaacgtaacacccttctcgcagcgactccgcaccatgcactacctcttcgagctg
ctctcacgcgccatggagtcgccggtgctgcggcagcacttctgcccgacatcggcgcgc
atgtgcgccgcaccgacaacacgctccatccgcggctgtcggaagcacacatccacggca
gcacaagcgcagcaaccacatagcggaatcggtcagcaccacggcggtcactttgtgtct
cgcatcccgtatcagctcgtgaagtctctcgaagacaccacgcagcgggtcctgcccgtg
taccttgacgcgggctacgaaggcgccgtcatccgcgccccggtgaacacgtacgacttc
aaggaaaagacgaagggcacgctggcggcactcgtcgctccacttctgcgggccgctgag
acgacgaagactcgtcgaggtcggcacctgcgtgggacaaacaccggtgcaggtgaagca
agtggtcgaagagctcgaaaccgcgccgccatgctactctccctaaacaccagacctgta
ttaggtgcggccacaccgctgatggtacacgcgtacaggggcaatgctccctgttgtgag
ccaatgcaacccatctcgccgtccgatgccggtctcactgatgccgagctggatgtcctg
gacgtcgtggccgtgggccggcgggcgatcttgcaaggtgcaaagctgccgctgcgctcg
atgaccgctgtcaaggtactcacataccacgatcgcgagtatcccatccttcgcccgctg
ctaaaagagccatcgaagaaccccagaacgcgggagctggtgtccatcccacgctcacac
gtgcgtgctctcgggtaccccataaagccaagcgccgacacggcactcagcgacgacaac
ggggcgacgacgctgactccggccaccccaccgggtgagaagaaggcgacgaagaggaag
aatcatcccaccacttccggcgaaggttcgactgtcttctacggacttcagtgcttggct
gagaacggactcgtcttcaacgtttccctgccaaagatgaccctcgctcaacagaagaca
ctgctgcagcacctcctgagcgcggggcgcgacgcgatgcgggacggcagggaggccgca
tctcccaccatgaatacccatcataacaagaagtcgaaggccaaggcgccgtatggaggg
gctacacacgcgggcgcctctaagatcgtctccctcacagggctctacgcgacagtgaag
ttcagcaccctgaccgagcacggcctgcctcgctttggcagcgtcaaggccattcgcggg
ggtaaaggatggttcatatga

DBGET integrated database retrieval system