KEGG   Leishmania mexicana: LMXM_13_1060Help
Entry
LMXM_13_1060      CDS       T02288                                 

Definition
putative NADH-cytochrome b5 reductase
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
lmi  Leishmania mexicana
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lmi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LMXM_13_1060
Enzymes [BR:lmi01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     LMXM_13_1060
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 308 aa AA seqDB search
MVAVLVIIAVSMAAFFAFMFTRTTKVAMDPTMFKHFRLIKRTEVTHDTFIFRFALENEAQ
TLGLPIGQHIVLRADCTTAGKTETVTHSYTPISSDDEKGYVDFMIKVYFADVHPSFPHGG
RLSQHMYHMKLGDKIEMRGPQGKFIYLGNGTSRIHKPGKGVVTEKVDAYAAIAGGTGITP
ILQIIHAIKKNKEDPTKVFLVYGNQTERDILLRKELDEAVANDTRFHVWYTIDREATPEW
KYDIGYVREEMFRKHLPVPDMLGDDSVPQNAGIKKVMALMCGPPPMVQMAIKPNLERIGY
TADNIFNF
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggtcgccgttctcgtcatcatcgccgtcagcatggcggccttcttcgcgtttatgttt
acgcgcacgacgaaggtggcgatggacccgacgatgttcaaacattttaggctgatcaag
cgcacggaggtgacccatgacaccttcatcttccgctttgccctcgagaacgaggcgcag
acgctcggacttccgatcgggcagcacattgtgctccgcgccgactgcacaacggcggga
aagacggagacagttacgcactcctacacgcccatctccagtgacgacgagaagggctac
gtggacttcatgatcaaggtgtactttgccgacgtgcaccccagcttcccgcatggcggc
cggctgtcgcagcacatgtaccacatgaagctcggcgacaagatagagatgcgtgggccg
cagggcaagttcatctacctgggcaacggcacctcgcgcatccacaagccgggcaagggc
gtcgtcacggagaaggtggacgcctatgcggccatcgccggcggcactggcatcaccccg
atcctgcagatcatccacgccatcaagaagaataaggaggacccgacgaaggtgttcctt
gtgtatggcaaccagacggagcgtgacattctactgcgcaaggagctcgacgaggccgtc
gccaacgacacccgctttcatgtatggtacaccatcgaccgcgaggcgacgccagagtgg
aaatatgacattggctacgtccgcgaggagatgttccgcaagcacctgcccgtgcccgac
atgctcggcgacgacagcgtgccgcagaacgccgggatcaagaaggtcatggcgctcatg
tgcggcccaccgccgatggtgcagatggcgatcaagccgaacctggagcgcatcggctac
accgccgataacatctttaacttctaa

DBGET integrated database retrieval system