KEGG   Leishmania mexicana: LMXM_14_0020Help
Entry
LMXM_14_0020      CDS       T02288                                 

Definition
putative phosphatidylinositol 3-kinase
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
lmi  Leishmania mexicana
Pathway
Inositol phosphate metabolism
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:lmi00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    LMXM_14_0020
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    LMXM_14_0020
Enzymes [BR:lmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     LMXM_14_0020
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 942 aa AA seqDB search
MNEWKSFQSVNPSVPERLAMRSLPQAFFVPPLPKARMDLLMQMWPSNAERGDGSISMRLW
YVDRAGSRCSSRQKFPFDTVADDAIRLTMSSILEFVKMEEKTGGTALIFVFRVKGRNEYI
YGSQPLINFRHIRECVSKQAEIDVVVEPKEATLFTAPLFRPSYLPRALANPCDAHSSKSS
TSDICLWDLANKLSLRVVGGFENLVISASRMKEENVRDSSNLYFAVLVEAYVGTWRCCEP
QITGWQLCKNAKNSHSLATKLQWEDGGKVSFSIDLSNVPRELRLCFTLVASSTDRIAGTR
AATAEEVIAAVEDNAKKPDYQGHSVFFLGTAATQLFDYAAVMRMGMWRIYLWDGKTRANP
IGLNSINPDSNACTFEVEFPCFDKPVCFPSGRPPQRKEEDARRSFASREAALSSHLINSE
VEQLRQLKRVLMYDPLVYLTSDDKTILWKYREALLGRPKAMAKVLSAVNWLMPFDVYEAH
CLLRRWSPLAAFDALELLDAHYADLVVREQAVEYIDKMSDYELRGCILQLVQVLKYESYH
YSALARFLLRRSLRSNHIIGHYVFWYLAAEVKNLTMCERHGLLLEELIKRSPHRLNYVRQ
VYVCNELLKCALKVQRAPKKDRVKCLRASLAKACFPDRFTLALNPSMECCAVDIDECKVM
ESKKFPLWLSFRNHLDQDERFLIIFKSGDDLRQDVLTLQLLEFMDSLWKASGLDLHLIPY
GCISTGEGVGMIEVVLNSDTIANITRREGGAQAAFNFDPIINWLRHFNHDRSEVERCLWN
FVLSVAGYTVATYVLGIGDRHNDNIMLREDGTLFHIDFGHFLGNFKSKFGIKRETAPFIF
TPMYLYAMGGSSSPIFKYFVDIACQAYNTLRGHSSALMMLFMLMLSTGIPELQTLEDIEW
LRRVLLLNWTDEEASKHYKGLINDALNNFRTLLNDYIHIMVH
NT seq 2829 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaatggaaatcttttcagtctgtcaatccatcggtgccagagcgcctcgcgatg
cgcagcctgccgcaggcgtttttcgtaccccctcttccaaaggcacgaatggatcttctg
atgcagatgtggccgagcaatgcggagaggggagatggcagcatctcgatgcgactgtgg
tacgtggatcgcgcagggtctagatgctcttcgaggcaaaagtttccgtttgacactgtc
gccgatgacgccatccggctcaccatgagcagcatactggagttcgtgaagatggaggag
aaaactggcgggacggcgctaatctttgtcttccgtgttaaggggcgaaacgagtacatt
tacggttcgcagcctcttatcaattttcgtcacattcgggagtgtgttagcaagcaggcc
gagatagatgtggtcgtggagccgaaagaagcgacccttttcacggcaccactttttcgc
ccgtcctatctgcctcgggcccttgcaaatccttgtgacgcacattcgtcaaagtccagt
acctctgacatctgtttgtgggacctggccaacaagctctctctcagggttgtcggcggt
tttgaaaatcttgttatctccgcgtcgcgcatgaaggaggaaaacgtgcgcgactcttcg
aacctgtactttgcagttcttgtggaggcgtatgttggcacctggcgttgctgcgaaccc
caaatcaccggctggcagctctgcaagaatgcaaagaacagccacagcttagctacgaag
ctgcaatgggaggatggtggaaaggtgtccttcagcatcgatctgtcaaatgtgccgaga
gagctaaggctgtgttttacgctggtagcttcctcgaccgacagaatcgccggtactcgg
gcagccactgcagaggaggtgattgccgctgtggaggacaacgctaagaaacccgactat
caaggccactcggtttttttcctgggtacggccgccacgcagcttttcgattacgctgcg
gtaatgcggatgggtatgtggcgcatctacctatgggatggcaagacccgcgcgaacccg
attggcttgaactccatcaaccccgattccaacgcgtgcacgttcgaggttgagttcccg
tgtttcgacaagcctgtttgttttcccagcggtcgacccccacagcgaaaagaggaggat
gctcggcgaagctttgctagccgtgaggccgccttgagcagccatctgatcaacagcgaa
gtagaacaactgcgccagctgaagcgggtgctgatgtacgaccccctggtgtatctcacg
agtgatgacaagactattctgtggaagtacagggaggcgctgctcggccgaccaaaggca
atggcgaaggtgttgagtgcggtgaactggctgatgcctttcgatgtgtacgaggcacac
tgtcttttgcgtcgatggtccccgctggctgcgttcgatgcgctggagctgcttgacgcg
cattatgctgacttggtggttcgtgagcaggcggtagagtacattgataaaatgtcggac
tatgagctgcgtggttgtattctgcaactcgtgcaggtactcaagtacgagtcgtatcac
tactctgctttggcgcgttttctccttaggcggtcgcttcgctcaaaccacataattggc
cactacgttttttggtacctagctgccgaagtcaagaacctgaccatgtgcgagcgacac
ggactccttttggaggaactgatcaagcgctccccgcatcggttgaactacgtgcgacaa
gtgtacgtttgcaatgagctgcttaagtgtgcactgaaggtgcagcgggcaccgaagaaa
gatcgtgtcaagtgtctgcgcgcgagtctcgctaaggcgtgctttcctgaccgctttact
ctcgctctgaacccctcaatggagtgctgcgcggtggatatcgatgagtgcaaggtaatg
gagtcgaaaaagtttccgctatggctttcttttcggaatcatctcgatcaagacgagcgc
tttttaatcatattcaagtctggcgacgacctcagacaagacgtgcttacactgcagctg
ctggagttcatggacagcctgtggaaagcgtccggtctggaccttcacctcatcccatac
ggttgcatctctacaggagaaggcgttggcatgatcgaagtggtgttgaacagtgacacg
atcgccaatatcacgagacgcgagggtggggcacaggctgcgttcaactttgacccgatc
ataaattggctgcgtcacttcaaccatgaccgaagtgaggtggagcggtgcctgtggaat
tttgtgcttagtgtcgccggctacacggtggctacctacgttctgggcatcggcgataga
cataatgacaacatcatgctccgagaggatggcaccctctttcacatcgattttggccac
tttctgggcaacttcaagagcaagttcggcatcaagcgtgagacagcacctttcattttt
actcccatgtacctgtatgcgatgggtgggtcgagtagcccgatcttcaagtactttgtg
gacatagcatgccaagcgtacaacacgctgcgggggcacagcagcgcacttatgatgctt
tttatgctgatgctctctacgggcataccggagctacaaaccctggaggatatcgagtgg
ctgcgcagagtacttcttcttaactggaccgatgaggaagcctccaagcactacaaaggc
ctcatcaacgacgcactgaacaattttcgaacactgctgaacgactacatccatattatg
gtgcactga

DBGET integrated database retrieval system