KEGG   Leishmania mexicana: LMXM_14_0350Help
Entry
LMXM_14_0350      CDS       T02288                                 

Definition
putative threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lmi  Leishmania mexicana
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lmi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LMXM_14_0350
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LMXM_14_0350
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LMXM_14_0350
Enzymes [BR:lmi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LMXM_14_0350
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 678 aa AA seqDB search
MLTLVITGRASKELKVQVRTVLVDDAQLFSATAASEDESGSVFVLRIDAEDSAVMEPLYQ
GYHYRFVWSAQSSMAELVSAVRHLLDSMASAQAHKDKRIGGSFISTRGASEASNFLDVVR
DGLASDGGLYILKQIPTMPGSQIYYFCKQRNLPYVEAAAMILEQLVDASITPSTLYPLIL
QAYDPSRWSDKDDICPVTPLLMGVETTPTREGGADAVDGHIPSASFNAPERWAANMSVVE
LFHGPTAAFKDFALQLFPRYFGTATVTQAKYKYVILAATSGDTGVAAISGFVNAGGHSQV
MVLYPMHGVSPVQRTQMLSFDNGTQVRAYAVDSNFDFCQRTVKELFSNAALRDELAVAEP
TAVRLSSANSINWGRLIPQVVYYFWAYRHHVQHPPAGWAFGDPIDVVVPCGNFGNILSGY
IAKIMGLPVRKLVVASNQNDVLYDFVKTGTYDMRNRALAVTSSPSIDILKASNVERFLYL
LSNGDTDLVERLMHELDTVGVFTLPDGVRAEMQSVFTAGRCSEEDCAATIKRIFELSSGS
RLLDPHTAVAVFVAQQFREEELLNRDLTNPTSSNTDTDMPPLVIASTAHWAKFPAPVLHS
LRGEGAQLGEPAPSVAAAIQEVRALYAEIKKAALKQQVHPALSHALDVAEEMAKEVRAVG
ADVAAIEEELRDFAKCYK
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgctcactcttgtcatcactggccgcgcatcgaaggagctgaaggtgcaggtgcgcacg
gtgttggtcgatgacgcgcaacttttcagcgctacagcggcctcagaagacgagagcggc
agcgtgtttgtgctgcgcatcgacgccgaagactcggcggtgatggagccactttaccag
ggataccactaccgctttgtctggtcggcacagagctcgatggcggagctggtgtcggct
gtgcgccacctcctcgactcgatggcatctgcccaagcgcacaaggacaagcgcatcggc
ggctccttcatcagcacccgcggcgcctccgaggcgtcgaacttcctggacgttgtccgc
gacggcttggcgagcgacggcgggctgtacattctcaagcagattcccacgatgccgggc
tcgcagatatactacttctgcaagcagcgcaacctcccctacgtggaggcggcggcgatg
attctggagcagctcgtggacgcgagcatcaccccgtcaacgctgtatcccttgattctc
caagcgtacgaccctagtcgctggtccgacaaggacgacatctgccctgtgacgccgctt
ctgatgggcgtggagaccacgccgaccagggaaggcggagctgacgcagtggacggtcac
atcccgtccgcctccttcaacgcaccggagcggtgggcggcgaatatgtcggtggtggag
ctcttccacggccctacagccgccttcaaggacttcgccctccagctcttcccgcgctac
tttggaacggcgactgtcacgcaggcgaagtacaagtacgtcatcctcgccgccacctcc
ggcgacaccggcgttgcggcgatcagcggtttcgtcaacgcgggcgggcactcacaggtc
atggtgctgtaccccatgcacggtgtctcgccggtgcagcggacgcagatgctctccttc
gacaacggcacgcaggtgcgggcctacgcggtggactcgaacttcgacttctgccagcgc
accgtgaaggagttgttctccaacgccgccctgcgcgacgaactcgcggtggcagagccg
acagccgtgcgcctctcgtccgccaacagcatcaactggggccgcctcattccgcaggta
gtctactacttctgggcgtaccgccaccacgttcagcacccgcctgcggggtgggccttc
ggcgacccgatcgacgtggtcgtgccgtgcggcaactttggcaacatcctgagcggctac
atcgccaagatcatggggctgcccgtgcgaaagttggttgtcgcctcaaaccagaacgac
gtgctctacgacttcgtgaagaccggcacgtacgacatgcgcaaccgcgctctggcggtg
acgtcgtcgccgtccatcgacatcttgaaggcctccaacgtagagcgtttcctgtacctg
ctgagcaacggagacacggatctagtggagcggctgatgcacgagctggacacggtcggt
gtcttcaccttaccagacggcgtgcgggcagagatgcagtccgtcttcaccgctggccgc
tgcagcgaggaggactgcgcggcgaccatcaaacgcatctttgaactatctagcggctcg
cggctgctcgacccgcacacggccgtcgccgtcttcgttgctcagcagttccgcgaggag
gaactcctgaaccgcgacctcaccaacccgacgtcttccaacaccgacaccgatatgccg
ccgctggtgatcgcgagcacggcgcactgggcaaagttcccagcgccggtgttgcattcg
ctgcgcggcgagggagcccaactcggtgagccggctccgtccgtcgccgccgccattcag
gaagtacgcgccctctacgcagagatcaagaaagcggccctgaagcagcaggtgcacccg
gccctgtcacacgcgctggatgtcgcggaggagatggcgaaggaggtgcgcgctgtcggc
gccgacgtggcggcgatcgaggaggagctgagggatttcgcgaagtgctataaataa

DBGET integrated database retrieval system