KEGG   Leishmania mexicana: LMXM_14_0510Help
Entry
LMXM_14_0510      CDS       T02288                                 

Definition
putative stearic acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
lmi  Leishmania mexicana
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:lmi01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:lmi01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 454 aa AA seqDB search
MLQAVRNLFTCSVLATDETSPKEEREVPQWTKGNFQYNWIGIYIISVPLLLVLLGLCLRV
PLSFSLLQWLAFFGVVTGMVGVTTGYHRLFSHNAFTGGQAMQWVCAFIGAGAFQGSIKWW
ARNHRVHHKYTDTSKDPYDARRGFIFTHFGWFVMRMDYDLLGDADVSDLKDSLVVEFQRK
YFAVIATMTGILIPLMVAGATTGEWAGAFFWVVWLKIFLVHQFSFFINSLAHTDLFGATR
PYADDKTPHDSIVFAIINLGEGYHNYHHQFPNDYRNGHLWHHIDMTKWYIFICSFLGFCD
NLQRAPRTIINRTAAAQGVCTQRRKLQEAVEKLKQLEVPADMEYTWDDVRAEVKQGRKLL
VMDGYVLDLERPIPVDPAWPQSEKISWLNTHPGGRALLLAYVGKDATAAFNGGVYGHTTG
AHNYLPELRVGRLKGLPASSASGEEGSAADCKGQ
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgctccaggcagtacggaacctcttcacctgcagcgtccttgccacggatgagacaagc
cccaaggaggaacgtgaggtgccgcagtggacgaagggcaacttccagtacaactggatc
ggcatctacatcatcagtgtgccactgctgctcgtcctgcttgggttgtgcctgcgcgtc
cctttatccttctcgctcctgcaatggcttgcatttttcggtgttgtcaccggcatggtg
ggggtgacgaccggctatcatcgtctcttctcacacaacgctttcaccggcgggcaggcg
atgcagtgggtgtgcgccttcatcggcgccggcgcgttccagggctccatcaagtggtgg
gctcgaaaccaccgcgtccaccacaagtacacggacacctccaaggacccgtacgacgcg
cgccgcggcttcatcttcacgcactttggctggttcgtcatgcgcatggactacgatctg
ctcggcgacgcagacgtgtcggacctgaaggacagcctcgtcgtggagtttcagcgcaag
tattttgccgtcattgcgaccatgacagggatcctgatccccctcatggtggccggcgca
accactggtgagtgggcgggtgcgttcttctgggtggtgtggctcaagatctttctggtg
caccagttctccttcttcattaacagcctcgcgcacacagacctctttggcgccacacgg
ccgtacgcggatgacaagacaccgcacgactccatcgtcttcgcgatcataaacctcggc
gagggctaccacaactaccaccaccagttcccgaacgactaccgcaacggtcatctgtgg
caccacattgatatgacgaagtggtacatatttatttgcagctttctgggcttctgcgac
aacttgcagcgtgcgccgcggactatcatcaaccgcaccgccgcggcgcagggtgtatgc
acgcagcggcgcaaacttcaggaggcggtcgagaagttgaagcagctggaggtgccggcg
gacatggagtacacgtgggacgacgtgcgggcggaggtgaagcagggccgcaagctgctg
gtgatggacggctacgtgctggacctcgagcggccaatccccgtggaccctgcgtggccg
cagtcggagaagatcagctggttgaacacgcaccctggtggacgtgcgttgctgcttgca
tacgtgggcaaggatgcgacggccgccttcaacggcggtgtgtatggccacacgacgggc
gcgcacaactacctgccggagctgcgcgtgggtcgcctgaagggcctccccgcctcttcg
gcgtctggcgaggaggggagtgccgctgattgtaaggggcagtga

DBGET integrated database retrieval system