KEGG   Leishmania mexicana: LMXM_15_0270Help
Entry
LMXM_15_0270      CDS       T02288                                 

Definition
putative replication Factor A 28 kDa subunit
Orthology
K10739  
replication factor A2
Organism
lmi  Leishmania mexicana
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lmi00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    LMXM_15_0270
   03420 Nucleotide excision repair
    LMXM_15_0270
   03430 Mismatch repair
    LMXM_15_0270
   03440 Homologous recombination
    LMXM_15_0270
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
15
AA seq 257 aa AA seqDB search
MLASTPGSNFGGAVASSNSSGGQQPQRRMHPIRPLTIKQMLEAQSVGGGVLVVDGREVTQ
ATVVGRVVGYENANMASGGGAITAKHFGYRITDNTGMLVVRQWIDADRMQEPLPLNTQVR
ASGTVNVWQQTPIVTGTVVSMADSNEMNYHMLDAILTHLRLTQGNKRAPSSGVSIQNTAS
AVGMHNMLPGGDNKVLLTDLLVSFIKQHGSSGAGMSMDELTMSAQRYGFTHGDVRTAMRT
LAAEGKVYQTHDNRFNI
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcttcgacccctggcagcaacttcgggggcgccgtcgcatcctcgaacagcagt
ggcggccagcagccgcagcgtcgcatgcatcccattcgccccctcacgatcaagcagatg
ctggaggctcagagcgttggcggcggtgttctggtcgtggacggccgcgaggtgacgcag
gcgaccgtcgttggccgtgtggtgggctacgagaacgccaacatggcctcgggtggtggc
gccatcactgccaagcactttgggtaccgaattaccgacaacacgggcatgctcgtcgtg
cgccagtggatcgatgcagacaggatgcaggagccacttccccttaacacgcaggtacgc
gcgtctggtacggtgaatgtgtggcagcagacccccatcgtcaccggcaccgtggtgagt
atggcggacagcaatgaaatgaattaccacatgctggacgccattctcacgcacttgcgt
ctgacacagggcaacaagcgtgccccgagcagtggtgtctcgatacagaacacggcctcg
gccgtcggcatgcacaacatgctgcctggcggcgacaacaaggtgctgctgacagacctc
ctggtctctttcatcaagcagcacggcagcagcggtgccggcatgtcgatggatgagctg
acgatgtcggcgcagcgctacggcttcacccacggtgacgtgcgcacggcgatgagaacg
ctggcagcggaggggaaggtgtaccagacccacgacaaccgcttcaacatctga

DBGET integrated database retrieval system