KEGG   Leishmania mexicana: LMXM_16_1310Help
Entry
LMXM_16_1310      CDS       T02288                                 

Definition
putative cytochrome c
Orthology
K08738  
cytochrome c
Organism
lmi  Leishmania mexicana
Pathway
Sulfur metabolism
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:lmi00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
16
AA seq 113 aa AA seqDB search
MPPKARPPLPPGDVERGEKLFKGRAAQCHTATKGGSNGVGPNLFGIVHRPSGKVEGFTYS
KANADSGVIWTPEVLDVYLENPKKFMPGTKMSFAGIKKPQERADVIAYLETLK
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgaaggctcgtcctcccctgccgcctggtgacgtggagcgcggcgagaagctg
ttcaagggccgcgctgcccagtgccacactgccaccaagggtggctccaacggtgtgggc
ccgaacctgttcggcatcgtccaccgcccctccggcaaggtcgagggcttcacgtacagc
aaggcgaacgccgattccggcgtaatctggacgccggaagtgctggacgtgtacctggag
aacccgaagaagttcatgcctggcacgaagatgtcgtttgccggcatcaagaagccgcag
gagcgcgccgacgtgattgcgtacctcgagaccctcaagtaa

DBGET integrated database retrieval system