KEGG   Leishmania mexicana: LMXM_18_0990Help
Entry
LMXM_18_0990      CDS       T02288                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase 2,putative
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lmi  Leishmania mexicana
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:lmi00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lmi00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:lmi00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lmi00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
18
AA seq 494 aa AA seqDB search
MENDMKSLSAAAQACAKKMRDAKVNEACIRTFVAQHVMVSKGETGFIPDSAIMPVDSLDA
LDSLTIECGNAVLQSTVVLKLNGGLGTGMGLHDAKTLLEVKDGKTFLDFTALQVQYLRQH
CSEHLRFMLMDSFNTSASTKNFLKSRYPWLYQVFDPEVELMQNQVPKILQDTLEPAAWAE
DPGCEWAPPGHGDIYTALYGSGKLQELVKQGYRYMFVSNGDNLGATIDKRVLAYMEKKKI
DFLMEVCRRTESDKKGGHLARQTVYVKGKDGQADAEKTVLLLRESAQCPKADMESFQDIN
KYAFFNTNNLWIRLPVLLETMKEHGGTLPLPVIRNEKTVDPSNSASPKVYQLETAMGAAI
AMFESASAIVVPRSRFAPVKTCADLLALRSDAYVVTDDFRLVLDDRCHGHPPIVDLDSAH
YKMMSGFEKLVQHGVPSLVDCKRVTVRGLVQFGADNVLTGTVKIENADSASPFVIPDGAK
LNDTTASPPQSTSK
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacgacatgaagtccctcagcgccgccgctcaggcgtgcgcaaagaagatgcgc
gatgccaaggtgaacgaggcgtgcatccgcaccttcgttgcacagcacgtcatggtcagt
aaaggcgagacggggttcattcccgactccgccatcatgccggtcgactccctcgatgcc
ctggacagcctcaccattgagtgcggcaacgctgtcctgcagagcaccgttgtgctgaag
ctgaacggcggcctcggcaccggtatggggctgcacgacgccaagacgctgctcgaggtc
aaggatggcaagacgtttcttgattttacagcgcttcaggtgcagtaccttcgccagcac
tgcagcgagcacctgcgctttatgctgatggacagcttcaacacctccgctagcaccaag
aactttctgaagtcgcgctacccgtggctgtaccaggtctttgacccagaggtagaactg
atgcagaaccaggtgcccaaaatactgcaggacacgctcgagccggcggcctgggccgag
gacccggggtgtgagtgggcgccgccggggcacggtgacatctacaccgctttgtatggc
tccggcaagctacaggaactcgtcaagcagggctaccgctacatgttcgtcagcaacggc
gacaacctcggcgccaccatcgacaagcgcgtgctggcatacatggagaagaagaagatc
gactttctgatggaggtgtgccgccgaacagagagcgacaagaaaggcggtcacctggcc
cggcagacggtgtatgtgaagggcaaggacggtcaggcagacgccgagaagacggtgctg
ctgctgcgggagtcggcccagtgccccaaggcggacatggaaagcttccaggacatcaac
aagtacgccttcttcaacacgaacaacctatggatcaggctcccggtgctgctggagacg
atgaaggagcacggcggcacgctgccgctgccggtcatccgaaacgagaagacagtcgat
ccatctaactcagcatcgcccaaggtgtaccagctggaaactgccatgggcgccgcgatc
gccatgttcgaaagcgcatcggccattgtcgtgccgcgcagccgcttcgcccccgtaaag
acgtgcgccgatctgctcgctctgcgctccgacgcctacgtcgtgacggacgacttccgg
ctcgtcctggacgaccgctgccacggccacccccccatcgtcgacctcgacagcgcgcac
tacaagatgatgagcggctttgagaagcttgtgcaacacggcgttccatcgctggtcgac
tgcaagcgcgtgacggtgagggggctcgttcagttcggcgctgataacgtgctcacgggc
acggtcaagatcgagaacgcggacagcgcctcgccgttcgtgatccccgatggcgccaag
ctgaacgacacaacggcgtcaccgccgcagtcgacaagcaagtag

DBGET integrated database retrieval system