KEGG   Leishmania mexicana: LMXM_18_1080Help
Entry
LMXM_18_1080      CDS       T02288                                 

Definition
(RefSeq) protein kinase A catalytic subunit
Organism
lmi  Leishmania mexicana
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 13447609
NCBI-ProteinID: XP_003874122
UniProt: E9ARP5
Position
18
AA seq 332 aa AA seqDB search
MITKAEASKWRLSDLEMRETVGTGTFGRVRLVKHKGTGQYAALKILKKQEILRMKQVDHV
MAEASLLQEIDHPFIVSMLRGYMDKNRLYILLEYVVGGELFSHLRKAGKFPNDVSKFYCA
EVILAFDYLHSKSIVYRDLKPENILLDQDGNIKITDFGFAKRVMERTFTLCGTPEYLAPE
IIQSKGHNKAVDWWALGILLYEMLVGYPPFFDDSPMKIYEKILLGKVLFPRWVDSKARDF
IKGLLSLDPTKRLGNLPNGAEDIKNHKYFAEVDWNVVLSKKIPAPIPVRQHKEGDTHYFD
KYPDSPLNPLRTLTPAQQDCFANFCNGQYTDE
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccaaggccgaagcttccaaatggaggctgagcgacttggagatgcgtgagacg
gtcggcaccggcactttcggccgagtacgcttggtgaagcacaaaggaacaggccagtac
gcggccctcaagatcctcaagaagcaggagattctccgaatgaaacaggtcgaccacgtg
atggcggaggcgagtcttctccaggagatcgatcacccttttattgtgagcatgctgcgg
ggatacatggacaagaaccggctgtacattctcctcgagtacgtggtaggcggcgagctg
ttctcacatctccgcaaggccggcaaatttcctaatgatgtctcgaagttctactgcgcc
gaggtgatcctagcatttgactacctgcacagcaagtcgatcgtttaccgcgatctgaag
ccggagaacattctcctcgaccaggacggcaacataaagatcactgatttcggattcgcg
aagcgcgtgatggagcgtacgtttacgctttgtggcacacccgagtacctagcccccgag
atcattcagagcaaggggcataacaaggctgtcgactggtgggcgctcggcatcctgctg
tacgaaatgctggttggctacccgccgttcttcgacgacagcccgatgaagatctacgag
aagatccttctgggcaaggtgctcttcccgcgatgggtagactcaaaggcccgagacttc
atcaagggtcttctatccctcgatcccacgaagcgccttggcaatttgcccaacggcgcg
gaggacatcaagaaccacaagtactttgcggaagtggactggaatgtagtgctgtccaag
aagattccagcgccaatcccggtgcggcagcacaaagagggcgatacccactacttcgac
aagtaccccgacagcccactcaaccctttgcgcactttgactccagcacagcaggactgc
ttcgccaacttctgcaacggccagtatacggacgagtag

DBGET integrated database retrieval system