KEGG   Leishmania mexicana: LMXM_18_1080Help
Entry
LMXM_18_1080      CDS       T02288                                 

Definition
protein kinase A catalytic subunit
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
lmi  Leishmania mexicana
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
18
AA seq 332 aa AA seqDB search
MITKAEASKWRLSDLEMRETVGTGTFGRVRLVKHKGTGQYAALKILKKQEILRMKQVDHV
MAEASLLQEIDHPFIVSMLRGYMDKNRLYILLEYVVGGELFSHLRKAGKFPNDVSKFYCA
EVILAFDYLHSKSIVYRDLKPENILLDQDGNIKITDFGFAKRVMERTFTLCGTPEYLAPE
IIQSKGHNKAVDWWALGILLYEMLVGYPPFFDDSPMKIYEKILLGKVLFPRWVDSKARDF
IKGLLSLDPTKRLGNLPNGAEDIKNHKYFAEVDWNVVLSKKIPAPIPVRQHKEGDTHYFD
KYPDSPLNPLRTLTPAQQDCFANFCNGQYTDE
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccaaggccgaagcttccaaatggaggctgagcgacttggagatgcgtgagacg
gtcggcaccggcactttcggccgagtacgcttggtgaagcacaaaggaacaggccagtac
gcggccctcaagatcctcaagaagcaggagattctccgaatgaaacaggtcgaccacgtg
atggcggaggcgagtcttctccaggagatcgatcacccttttattgtgagcatgctgcgg
ggatacatggacaagaaccggctgtacattctcctcgagtacgtggtaggcggcgagctg
ttctcacatctccgcaaggccggcaaatttcctaatgatgtctcgaagttctactgcgcc
gaggtgatcctagcatttgactacctgcacagcaagtcgatcgtttaccgcgatctgaag
ccggagaacattctcctcgaccaggacggcaacataaagatcactgatttcggattcgcg
aagcgcgtgatggagcgtacgtttacgctttgtggcacacccgagtacctagcccccgag
atcattcagagcaaggggcataacaaggctgtcgactggtgggcgctcggcatcctgctg
tacgaaatgctggttggctacccgccgttcttcgacgacagcccgatgaagatctacgag
aagatccttctgggcaaggtgctcttcccgcgatgggtagactcaaaggcccgagacttc
atcaagggtcttctatccctcgatcccacgaagcgccttggcaatttgcccaacggcgcg
gaggacatcaagaaccacaagtactttgcggaagtggactggaatgtagtgctgtccaag
aagattccagcgccaatcccggtgcggcagcacaaagagggcgatacccactacttcgac
aagtaccccgacagcccactcaaccctttgcgcactttgactccagcacagcaggactgc
ttcgccaacttctgcaacggccagtatacggacgagtag

DBGET integrated database retrieval system