KEGG   Leishmania mexicana: LMXM_19_0030Help
Entry
LMXM_19_0030      CDS       T02288                                 

Definition
histone H2B
Orthology
K11252  
histone H2B
Organism
lmi  Leishmania mexicana
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
19
AA seq 107 aa AA seqDB search
MASSRKASHVRKSHRKPKRTWNVYVGRSLKAINSQMSMSHRTMKIVNSYVNDVMERICTE
AASIVRANKKRTLGAREVQTAVRIVLPAELAKHAMAEGTKAVSSASR
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttcccgcaaggcttcccacgtgcgtaagtcgcaccgcaagccgaagcgcacg
tggaacgtgtacgtgggccgctcgctgaaggcgatcaactcccagatgtcgatgtcgcac
cgcacgatgaagatcgtgaattcgtacgtgaacgacgtgatggagcgcatctgcaccgag
gctgcgtcgattgttcgcgcgaacaagaagcgcacgctgggtgcgcgcgaggtgcagacg
gcggtgcgcattgtgctgccggcggagctcgcgaagcacgccatggctgagggcacgaag
gccgtgtcgagcgcgtcccgttaa

DBGET integrated database retrieval system