KEGG   Leishmania mexicana: LMXM_19_0050Help
Entry
LMXM_19_0050      CDS       T02288                                 

Definition
(RefSeq) histone H2B
  KO
K11252  histone H2B
Organism
lmi  Leishmania mexicana
Brite
Chromosome and associated proteins [BR:lmi03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    LMXM_19_0050
Exosome [BR:lmi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   LMXM_19_0050
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF GMP_synt_C
Motif
Other DBs
NCBI-GeneID: 13447736
NCBI-ProteinID: XP_003874183
UniProt: E9ARV5
Position
19
AA seq 107 aa AA seqDB search
MASSRKASHVRKSHRKPKRTWNVYVGRSLKAINSQMSMSHRTMKIVNSYVNDVMERICTE
AASIVRANKKRTLGAREVQTAVRIVLPAELAKHAMAEGTKAVSSASR
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttcccgcaaggcttcccacgtgcgtaagtcgcaccgcaagccgaagcgcacg
tggaacgtgtacgtgggccgctcgctgaaggcgatcaactcccagatgtcgatgtcgcac
cgcacgatgaagatcgtgaattcgtacgtgaacgacgtgatggagcgcatctgcaccgag
gctgcgtcgattgttcgcgcgaacaagaagcgcacgctgggtgcgcgcgaggtgcagacg
gcggtgcgcattgtgctgccggcggagctcgcgaagcacgccatggctgagggcacgaag
gccgtgtcgagcgcgtcccgttaa

DBGET integrated database retrieval system