KEGG   Leishmania mexicana: LMXM_19_1440Help
Entry
LMXM_19_1440      CDS       T02288                                 

Definition
(RefSeq) mitogen-activated protein kinase
Organism
lmi  Leishmania mexicana
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
19
AA seq 363 aa AA seqDB search
MTQLVPLAELPSGKKIYSVRGQRFEVDRQYDLVKVVGFGACGTVCSAVVNGSGERVAIKR
LSRVFGDLREGKRILREMEIMTSLKHNNLIRLHHFMRPQSKETFEDIYLVMDLYDTDLNR
IIRSRQKLTDEHLQYFMIQAFRGLHYLHSAKVMHRDLKPSNLLVNADCALAICDFGLARD
DQVMSSSDLTQYVVTRWYRPPEVLGMGSNQYTSAVDVWSLGLIFAELMVGRALLPGTDYI
GQLVMIVNLLGSPSIDDMEFLSSEAKAFILSQPHRPALSFRDLFPMATEEATDLLSKLLV
FHPARRLTAKQVMEHPYFSKYRDAAEEADAPDPFVWNHSHIETKEQLREDLWRVVEAHSQ
LNE
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgactcagctcgtccctttagctgaacttcccagcgggaaaaaaatatatagtgtccgg
gggcagcggttcgaagtggacaggcaatatgatctggtcaaggttgttggatttggtgcg
tgtggcactgtttgttcagcggtcgtgaacgggtcaggtgagcgagtggctatcaagcga
ttgtcgcgtgtctttggtgatcttcgtgaagggaaacgaattttgcgggagatggagata
atgacgtcgctgaagcacaataatctgattcgcctccaccacttcatgcggccgcagtca
aaggagacgtttgaggacatttacttggtgatggatctttatgacacagatttaaatcgt
attatacgaagtcggcagaaactcactgatgaacatctgcagtattttatgattcaagca
ttccgcggattgcattaccttcactctgccaaggtgatgcatcgagacctgaagccgagc
aacttgcttgtaaatgcggactgcgcgctagcaatctgcgattttgggctggctcgtgat
gatcaagtgatgagctcgtcagatctcacacagtacgtcgtaacacggtggtacagaccc
cctgaggtactcgggatgggatccaatcagtacacgagcgcggtagatgtctggagcctt
ggtctaatctttgcggagctgatggtagggcgcgctctgcttccaggaacagattatatt
ggacagctggtaatgattgtcaatctattaggatccccgtccatagatgacatggagttt
ctgagctcagaagcaaaggcatttattctctctcagccgcatcggccggctctctccttc
agagatctttttccaatggctacagaagaggcaactgaccttctgtcgaagctgctcgtt
ttccatcctgcaagacgattaactgcgaagcaagtgatggagcatccatatttttcaaag
tacagggatgccgcagaagaagctgacgctcctgatccgtttgtgtggaatcacagccat
atagaaaccaaagagcaactccgtgaggatttgtggcgcgttgtcgaagcccattcacaa
ttgaacgaatag

DBGET integrated database retrieval system