KEGG   Leishmania mexicana: LMXM_19_1480Help
Entry
LMXM_19_1480      CDS       T02288                                 

Definition
eukaryotic translation initiation factor-like protein
Orthology
K03259  
translation initiation factor 4E
Organism
lmi  Leishmania mexicana
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:lmi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    LMXM_19_1480
Messenger RNA biogenesis [BR:lmi03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     LMXM_19_1480
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     LMXM_19_1480
Translation factors [BR:lmi03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    LMXM_19_1480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
19
AA seq 281 aa AA seqDB search
MDPSRCAPASAVTDEQPLTLLWGTWEMWCDMPQRQQGHGTENTNWLEQVKSIGLFDSAEG
FWGIFNCTILPSQLPPNGSYYLFRKHIAPMWEHEANRRGGKWVIPFTGKASRGEGDLQPV
DVAWQALCLSAIGELFPDDEEEICGVTVSRGRQRTFPSGHATSVLGEWKLCLWTRGADNR
ESQMRIAEYICKQLHLLPLSKEGSRDGQSGETDKLVMMPLYPDPSPAAKTREASGISSGM
TYVAHRDLMEAKQEFVKGGSRVVQAFRPKYTLAIDVRGEVV
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggatccgagtaggtgtgccccggcgagcgctgtgacagatgagcagccgcttactctg
ctgtgggggacgtgggagatgtggtgcgacatgccgcagcgacagcaaggccacggcaca
gaaaataccaactggctggagcaggtgaagagcattggcttgttcgacagtgctgagggc
ttctggggaattttcaactgcaccatcctgccatcacagctcccaccgaacggctcctat
tacctttttcgaaaacacattgccccaatgtgggagcacgaggcaaaccgcagaggcggg
aagtgggtgattccctttaccggcaaggcgtcgcggggtgagggtgatttgcagccggtc
gatgtggcttggcaggcgctgtgcctctccgcgattggggagctctttcccgacgacgag
gaggagatctgcggcgtcactgtgagtcgtgggcggcagcgcacctttccctctggccat
gcgacgtctgtgctaggtgagtggaagctttgcctgtggacccgcggtgccgacaacagg
gaatcgcaaatgcgcattgcagagtacatttgcaagcagctacacttgctgcccttgtcg
aaggaggggagtagggatggacaaagcggcgaaactgacaaattggtgatgatgccgctg
tacccagacccttccccagccgccaagacacgggaggcatctgggatttcgtctggaatg
acctatgtagcgcaccgggacttgatggaggcaaagcaggagttcgtgaagggcggaagc
agggttgttcaagcgttcagacccaagtacactcttgcaatcgatgtgaggggtgaggtt
gtgtga

DBGET integrated database retrieval system