KEGG   Leishmania mexicana: LMXM_20_0280Help
Entry
LMXM_20_0280      CDS       T02288                                 

Definition
developmentally regulated phosphoprotein-like protein
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
lmi  Leishmania mexicana
Brite
Enzymes [BR:lmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     LMXM_20_0280
Protein kinases [BR:lmi01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   LMXM_20_0280
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
20
AA seq 453 aa AA seqDB search
MMRRLLPTTKLLGSTTGISLASTKSPDTERLERLVEEVNGIKSKLKVLEESKAANGLVDL
YASRKMKRLDIKRILAIFNDRAYHAPIFCHKALPIILAHFITGLDRLPSGLNAMPSILAV
RATLLHSFQKLINCKIPATDDQVQHFCRVLEDIDEEHAERNLLQTMAFGILELKEYVSSH
RRALVDLKKTSERWASIPMTEENVLTYAEIQEIQAPLDSVNRCMITYNFISRMFLNHDPD
MTTCSNPRHIGMVDLEMNLEHVVRNAVDEAKQICTDHYGDCPDTEFELTSDSKAFRFPYM
STTIRYIILELMKNAFRATVESHMKRNEVGMVTCADMPPIRVLINLQEGTEHACICISDE
GMGMTDEALAMAMAYSYTSVSKPALQLGESGERCGSTTPSPLAGYGYGLPMSRVYAQSLG
GDLFLQTMEGYGTRAYYYIKIADAQPLCDEETK
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgatgcggcgattacttccgaccacgaagttactcggctctacgaccggtatcagtttg
gcatcgacaaaaagcccagacacggagcgcttagagaggcttgtggaggaggtgaatggc
ataaagtcgaagctgaaagttctggaagagagcaaagctgcgaacggattggttgacctt
tacgcctctcgcaaaatgaaaagactggacattaagcgtatcctggcaatcttcaacgat
agggcgtaccacgcgccaatattctgccacaaagcacttccgattatcctggcgcacttc
atcaccggactcgacagacttccctctggcctcaacgccatgccgtcgattttggccgtt
cgtgcaacgcttctccactcgtttcagaaactcatcaactgcaaaatccccgccaccgac
gaccaagtgcagcacttttgcagagtgttggaggacattgacgaggagcacgcagagcgc
aacctgctgcaaaccatggcatttgggatcctggagctgaaggagtacgtttcatctcat
cggcgagcactggtggatcttaagaagacatccgagcggtgggccagcatccccatgacg
gaggagaacgtgctcacctacgcagagatccaagagatccaagctccactggactctgtg
aatcgttgtatgatcacgtacaacttcatctctcggatgttcctcaatcacgacccggat
atgactacgtgcagcaatcccagacacatcgggatggttgatcttgagatgaatcttgag
catgtagttcgcaacgctgttgacgaggcgaagcagatttgcacggatcactacggcgac
tgcccagataccgagtttgagctgacctcggactccaaggctttccgattcccctacatg
agcacaactatccggtacattatattggaactgatgaagaacgcgtttcgtgcgacagtg
gagtcacacatgaagcgcaacgaggtcgggatggttacgtgcgctgatatgccgcccatt
cgcgtgttgatcaacttgcaagaagggacggagcatgcgtgcatctgcatctcggatgaa
ggcatgggcatgacggacgaagcacttgccatggcaatggcgtactcatacacatcagtc
agcaaaccagctctgcagcttggtgagtcaggcgagagatgtggatctacaacgccatca
ccgctagctggctacgggtacgggcttccgatgtcgcgcgtgtacgcacagtcgcttggt
ggcgaccttttcttgcagaccatggagggctacggtacgcgtgcctactactatatcaag
atagcggatgcacaacccttatgcgacgaggaaaccaagtag

DBGET integrated database retrieval system