KEGG   Leishmania mexicana: LMXM_20_0970Help
Entry
LMXM_20_0970      CDS       T02288                                 

Definition
hypothetical protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
lmi  Leishmania mexicana
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:lmi00270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
20
AA seq 344 aa AA seqDB search
MTDCWYIPEVLADRRDENRLSPNVSGSYEVLGEAGIFYRHFDPKEVSDDIEGFIQPLLKK
LNYHSYDVVNLSPANLGAEKFETLAEQHFTEHIHEDDEVRLILEGQGYFDVRDINDKWIR
LLSKPGDCIVVPAGMYHRFTTDQSKYIKTLRIFKEAPRWIALNRSPEAEEKPARKEYLAR
LHAPAETAVGAANSRTIFSLRYPLKLDAELTVMAKQLLEQHSQQSHALMIYLTGSTDPTT
GESWCPDCVLAKPQVAKRFAELQGKYGEEHAIFLQLPVERASYLGNPNFLYRTHPTLQLA
SVPTLLVLTPTKDAKEKGDVQWYDLLDVKVRTCDADKADVLNLE
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgactgactgctggtacataccagaggtgctggcggatcgccgcgatgagaaccgtctt
tcgccaaacgtgtccggcagctacgaagtgcttggtgaagcagggatcttctaccgtcac
tttgacccgaaggaggtaagcgacgacatcgagggcttcatccagccgcttctcaagaag
ctcaactaccacagctacgacgtcgtgaacctcagcccggccaacctcggcgcagagaag
ttcgagactctggcagagcagcacttcacggagcacattcacgaagacgatgaggtgcgg
ttgattctcgaaggtcaaggctactttgacgtgcgcgatatcaacgacaagtggattcga
ttgctgtcgaagcctggcgactgcatcgttgtaccggccggtatgtaccaccgcttcacg
acggatcagagcaagtacatcaagacgctgcgcatcttcaaggaggctccgcgatggatc
gcgctgaaccgcagcccggaggcggaggagaagccggcgcgcaaggagtacctcgcccgc
ctgcacgcccctgccgaaacggctgtcggcgccgccaacagtcgcacgatcttctctctg
cgctacccgctgaagctggacgcggagctcaccgtcatggcgaagcagctgctggagcag
cacagccagcaatcgcatgccctcatgatttatctgacaggctccaccgatccaactacc
ggcgagtcctggtgcccggactgtgttctggcgaaaccgcaggtcgcgaagcgctttgca
gagctccaaggcaagtatggtgaggagcacgccatcttcctgcagctcccggtcgagcgc
gccagctacctgggcaacccgaatttcctctatcgcacacacccgaccctgcagctggct
agtgtgccgacgctgctcgtgctgacgccgaccaaggacgccaaggagaaaggcgacgtg
cagtggtacgacctgctcgacgtcaaggtgcgcacctgcgatgctgacaaggcagatgtg
ctgaacctcgagtaa

DBGET integrated database retrieval system