KEGG   Leishmania mexicana: LMXM_21_1630Help
Entry
LMXM_21_1630      CDS       T02288                                 

Definition
putative calcineurin B subunit
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
lmi  Leishmania mexicana
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
21
AA seq 175 aa AA seqDB search
MNEVPLTAEELQYIRESTALTDAQVQRLYKSFSRLNKDKSGKITRAEFNSIPALASNPLV
DRVLAVMDTDGDSTVDFGDFVRALAVLSSATSKEDKLRFTFKMYDIDGDGRISNRDLFQM
LSIMVGVNLSQMQLQQIVDKTFIEADVDRDGYITFEEFEALAVNSDFGDRLNLHF
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaggttccactcacagcggaggagctgcagtacatccgcgagtccacggcgctc
acggacgcgcaagtgcagagactgtacaagagcttttccagactaaacaaagacaagtct
ggcaagatcactcgggcggagttcaactcgattcctgcactagcctccaacccactcgtc
gacagagtgctggcggtgatggacacggatggcgactccacggtggactttggcgacttt
gtgcgggcactagcggtgctctcctcggcgacctcgaaggaggataagctgcggttcacg
ttcaagatgtacgacatcgacggtgacggccgcataagcaacagggacctctttcaaatg
ctcagcatcatggttggggtgaacctctcccagatgcagctgcagcagattgtggacaag
acgttcatcgaggcggacgttgatcgggatggctacattacttttgaggagttcgaggcg
ctggccgtgaacagcgactttggcgatcgtctgaacctgcatttttag

DBGET integrated database retrieval system