KEGG   Leishmania mexicana: LMXM_22_0780Help
Entry
LMXM_22_0780      CDS       T02288                                 

Definition
putative NADH-cytochrome b5 reductase
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
lmi  Leishmania mexicana
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lmi00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
22
AA seq 289 aa AA seqDB search
MKAVIAAAMGFATSSWYNSVSSSSNCATPSSPFSQSEFRSFPLMDVYDESHNTKVFRFAL
PEADMPLNLEVASCVSFRFFDKDGKEVIRPYTPLNRSDQLGYFDVMVKKYQGSKMGTHLF
SMKKGDTIDVKGPWMKLPIKANQYKTIGMIAGGTGITPMYQVARHVFHTPKNNTEITLIY
ANERKEDVLLGNELNELMEAYPRFSPYFVLSKAPSDWMGGVGYVNKEMIKSLMPAPNRAG
DSIILVCGPPPFMEAISGDKDFKSNPPSQGELKGYLKELGYMPKMVYKF
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgtcatcgcggccgcgatggggtttgcaacctccagctggtacaacagcgtt
tctagctcatccaactgcgccacgccgagcagcccattctcgcaatctgagtttcgctcc
tttccgttgatggatgtctatgacgagtcccataacacgaaggtgttccgctttgcgttg
ccggaggccgatatgccactgaacctggaggtagctagctgtgttagcttccgctttttc
gacaaagatgggaaggaggttattcgcccctacacaccgcttaaccgcagtgatcagctt
ggctacttcgatgttatggtgaagaagtaccagggctcaaagatgggcactcatttgttc
tcaatgaagaagggtgacaccatcgacgtcaagggaccgtggatgaaattgccgatcaag
gcaaatcaatacaaaacgattggcatgattgccggtggtacgggtatcacgccgatgtac
caggtagcgcgccatgtgtttcacacaccgaagaacaacacagaaatcacgctcatctac
gcaaatgaacgcaaggaagacgtgctgcttgggaacgagctgaacgagctaatggaggcg
tacccacgcttttcgccgtactttgtgctatcgaaggcaccatctgactggatgggcggc
gtcggctatgtcaacaaggagatgatcaagtcactgatgcctgcgccgaaccgtgcgggt
gattctatcattcttgtctgtggaccgccgccatttatggaagctatttcgggtgataaa
gacttcaagagcaacccaccatcccagggtgagctgaagggctacctgaaggaacttggc
tacatgccgaagatggtgtacaagttttag

DBGET integrated database retrieval system