KEGG   Leishmania mexicana: LMXM_23_0070Help
Entry
LMXM_23_0070      CDS       T02288                                 

Definition
agmatinase-like protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
lmi  Leishmania mexicana
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmi00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    LMXM_23_0070
Enzymes [BR:lmi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     LMXM_23_0070
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
23
AA seq 332 aa AA seqDB search
MFAKFLSRVKALPPRSGDWANKLGPVALMGCSGGAHMSSTKLLNHFYTSPRDCDMYAELT
FHEPGPVECPPETVIFFPVIQCGEMLDDKSEPSKATKDDWYLAMTEATTELLEKGYVPVS
AGGDGSATLAMVEAYKRLFRSSEVVLIHCSARPALEKAEQPIRVLLEKDLLKGVVEIGNR
CVSSGDRKVRKQHKVMYMDMQAIYAKGLFCIRDIRNDYPVFLSIDADVLDPAFAPAVQSP
VPGGLSTRDLLHIMTGIRGPKVAGIDIHGYHPSLDMCRSDGVGLTQMALTKVLKESIVKA
YTISTQTAEEGLERVRLMQRQGTLSDNPYPDY
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgttcgccaagttcctctctcgcgtgaaggccttgccgccgagatcgggtgactgggct
aacaagctgggacctgtggcgctaatgggctgctcgggcggagcacacatgagttcgacg
aagcttctgaaccatttctacacgtccccgcgagactgcgacatgtatgcggagttgacc
ttccatgagcccggccctgtggaatgtccaccagagacggtcatttttttccctgtgatc
cagtgtggtgaaatgctggatgacaagagtgagccgagcaaggccaccaaggacgactgg
tacctggcgatgacagaagccacgacagagttgctggagaagggctacgtcccggtgagc
gccggcggtgatggctctgcgacgctggctatggttgaggcgtacaagcggctctttcgg
tcaagcgaggtggtgctgattcactgctctgccagaccggcgctggagaaagcggaacaa
ccgattcgtgtactgctcgagaaggacctattgaagggtgttgtcgagattggtaatcgc
tgtgtctcgtccggcgaccgcaaggtccgcaagcagcataaggtgatgtacatggatatg
caagccatatacgcaaagggtctattttgcattcgcgacatccgcaatgactatccagtc
tttttgagcattgacgctgatgtactggatccggcttttgcaccggccgtgcagtcaccc
gtgccagggggtctctctacgcgggacctgttgcacatcatgaccggcattcgagggccc
aaggtggctggaatcgacatccacgggtaccaccctagtctggacatgtgccgtagcgat
ggcgttggcctgacccagatggcgttgacgaaggtgttgaaggagtcgattgtcaaggcg
tacaccatctccacacagactgcggaggagggtctcgagagagtgcgcctgatgcagcga
cagggcacgctgtctgacaacccataccctgattactga

DBGET integrated database retrieval system