KEGG   Leishmania mexicana: LMXM_23_0880Help
Entry
LMXM_23_0880      CDS       T02288                                 

Definition
(RefSeq) beta-fructosidase-like protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
lmi  Leishmania mexicana
Pathway
lmi00052  Galactose metabolism
lmi00500  Starch and sucrose metabolism
lmi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LMXM_23_0880
   00500 Starch and sucrose metabolism
    LMXM_23_0880
Enzymes [BR:lmi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     LMXM_23_0880
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N
Motif
Other DBs
NCBI-GeneID: 13454386
NCBI-ProteinID: XP_003875725
UniProt: E9AWA3
Position
23
AA seq 378 aa AA seqDB search
MQQRAPAYAPRDTHAERLAAADREAAARWDSSTNRTWYPDYHIAPYTGWMNDPAGLVHFR
DLYHAFYQYHPYSAEWGSMHWGHLTSEDLVHWQHEKTALAPGDACDRDGCFSGTTVVHED
RMYVFYTGHFVLEAATPRNPDAIFEQQCVAVSSDGVNFEKLGAVVRPPPGYVHFRDPKVW
QQDGRWWMVCGARDATRDLGQLLLFTTEDLLRWDDTNWQVLGMTEDKNVFMWECPDLFSV
GSREDMKLLLFCPQGKKASEYNYRNRFQNGYTVGQWMPDGPWTVQREFRELDCGHDFYAA
QTFLAADGQRRLLMAWCNMWESPMPTRGHGWSGCLTLPRELSYNEATGQLRMLPARELVG
LRAPEMITLPNVVNESXL
NT seq 1133 nt NT seq  +upstreamnt  +downstreamnt
atgcaacagcgcgcaccggcctacgctccgcgcgacacccatgccgagcggctcgcggct
gcggaccgggaggctgctgctcgatgggactcctcgacgaaccggacatggtacccggac
taccacattgcaccatacacggggtggatgaacgacccggccgggctggtgcactttcgc
gatctctaccacgctttttaccagtaccacccgtacagtgccgagtggggttcaatgcac
tggggccacctgacgagcgaggacttggtgcactggcagcacgaaaagacggcgctggca
cctggcgacgcgtgtgatcgcgatggctgcttctctggcaccaccgtcgtgcacgaagac
aggatgtacgtcttctacacaggccacttcgtgcttgaagcggcgacgccacggaacccg
gacgccatctttgagcagcagtgcgtcgccgtgagcagcgacggcgtgaactttgagaag
ctcggtgccgtcgtgcgcccgccaccagggtacgtgcacttccgcgacccgaaggtgtgg
cagcaggacgggcggtggtggatggtgtgcggtgcccgtgacgcgacgagggaccttggc
cagctgctgctcttcaccacagaagacctgcttaggtgggatgacacgaactggcaggtg
ctggggatgacggaggacaagaacgtgttcatgtgggagtgccccgacctcttttcggtc
ggcagtcgtgaggacatgaagctgctacttttctgccctcaaggtaagaaggccagcgag
tacaactaccgcaatcgcttccagaatgggtataccgtcgggcagtggatgcctgacggt
ccgtggacggtgcagcgggagttccgtgagcttgattgcggccatgacttctacgcagca
cagacgttcctcgccgccgatggccagaggcggctgctgatggcgtggtgcaacatgtgg
gagagccccatgccgacgcgcgggcacggctggagcggctgcctgacgctgccgcgggaa
ttaagctataacgaggcaacaggacagcttcgaatgctgccggcgcgtgagctggtcggc
ctccgtgcgcccgagatgatcactctgcctaacgtcgtcaacgaatcaagnct

DBGET integrated database retrieval system