KEGG   Leishmania mexicana: LMXM_24_0010Help
Entry
LMXM_24_0010      CDS       T02288                                 

Definition
pyruvate dehydrogenase (lipoamide) kinase,putative
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
lmi  Leishmania mexicana
Brite
Enzymes [BR:lmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     LMXM_24_0010
Protein kinases [BR:lmi01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [Table]
   LMXM_24_0010
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
24
AA seq 451 aa AA seqDB search
MLRRGFCRSIPLLGPTFTELVERLDSFEKEFIEWKAFRKAVESTSPKVTEAAKEIIAESM
EEVKTSKVNLENPLTPEEFTELNQFYAKQKVKDIFFENLLYINTPNDLMQHSEIVFRQYL
VRIARRVRHLSHAPYGLSQMPGIQMLKKWYQWSFHDVRSTPVPTTRDGCFRCDRMVRRVF
LRHYNVSSLITDGMVEFASREGWTHVDEEVMRTYDELQAFFEAFCLGRVRLRFLVGNYMY
LSTKILGVSREEYAVNDPDGLTVPIFFDHNADDFVGQICKKCSLLVLTKCAIKEAQANYD
AEIELKLAGDPNLVFVGVPYITYDIICAMLEDAVSANVDRQEQTGKACTNIEVTLAQWPT
NKRFVLRISDTAGGMTLRQAAKQLSCWSLYRNIQGHNEDTISTWTSSPIRLPYAYNAARV
IGGNITLASIEGYGTDRQLYLPSTGLAGVSL
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgtagaggcttttgccgcagtatcccgctcttgggacccaccttcacagagctt
gtggagcgcctggactcttttgagaaggagttcattgagtggaaggcgtttcgcaaagcg
gtggaatcaacgtcgccgaaggtgacggaggcggcgaaggaaattattgcggagagcatg
gaggaggtgaagacgagcaaggtgaacttggaaaacccgctgacgcctgaagagttcaca
gagttgaaccagttctacgccaagcagaaggtgaaggatatattcttcgagaacttgctc
tatatcaacacaccgaatgatttgatgcagcattcggagatcgtttttcgccagtacctt
gtgcggattgcccgtcgcgtacgtcacttgagccatgcaccgtacggcctatcacaaatg
ccgggaatccaaatgttgaagaagtggtaccagtggagttttcacgacgttcgtagcact
ccagttccaacgacccgagatggatgcttccggtgcgaccgcatggtgcgacgtgttttc
ctccgccactataacgtgagctctctcatcaccgatggtatggtcgagtttgccagccgc
gagggatggacgcatgtagacgaagaggtgatgcgcacgtatgatgagctgcaggccttt
ttcgaggcattttgcctgggtcgcgtccgtcttcgctttttggtaggcaattacatgtat
ctttccaccaaaatcctcggtgtctcgagggaggagtacgccgtgaacgatccggacggg
ctcacagtgcccatctttttcgaccataatgcagatgactttgttgggcagatctgcaag
aaatgctctctcttggtcctcacaaagtgcgcgatcaaggaagcacaggctaattatgat
gcggagatcgagctaaaactggctggggatcctaatttggtcttcgtcggggtaccgtat
atcacgtacgacatcatttgcgcgatgctggaggacgctgtttctgctaacgtagatcgt
caggaacagacaggcaaggcgtgcacgaacattgaagtcacgcttgcgcagtggccgaca
aacaagcgctttgttctgcgtatatcggacacggcgggcggaatgaccttacgccaggct
gcgaagcagctgtcctgctggtctctttacagaaacattcagggccataatgaggatacg
atttcaacgtggacgtccagcccgattcggctcccctatgcgtacaatgccgcgcgcgtg
attggtgggaacatcacgttggcgtccattgaaggctacgggacagataggcagctgtat
ctcccttctaccggacttgctggtgtgtctctatga

DBGET integrated database retrieval system