KEGG   Leishmania mexicana: LMXM_24_1370Help
Entry
LMXM_24_1370      CDS       T02288                                 

Definition
putative histone deacetylase
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
lmi  Leishmania mexicana
Brite
Enzymes [BR:lmi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     LMXM_24_1370
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
24
AA seq 545 aa AA seqDB search
MSSPEQLPALSAGGSPSSGGASSHHSPHEASLPFPASAITGDASAESPRASSVPPSSTAS
EESAATSPLERKPDAAASRPGRRKVVYFVDHSVTAIAYAEGHLMRPSRVRALHALVHSLG
LDSAEYMTVCHARPATAEEMGAFHRSAYLECLRQAPVICGNPLDEISLAFQKEFDVPFAS
QNGDCPLFPEVWALVSSQAGASLACAEALVRGDATVAMNWAGGMHHAAAAHASGFCFVND
IVLCIRRLLRHYQRVLYVDLDVHHGDGVEGAFYGNHRVMTLSLHQFGNGFFPGTGDYPTR
ETADSFAINVPLPTRTGDAAYLLSFRTALSSVVQCFDPEAMVVQCGADTIAGDLIGRLCV
TTLAHTQCVADVLSLERPTVLLGGGGYHVFHTARCWAIHTATALGRTAAQLPLYIPRTDP
YYMDYRRECTPKRPTLHVFLDPDVDDPLPLGDSLAFWRQLCRSIQWQMRTARLVRQGFSR
TVQLCRQRRAALLRQFATQEAGRDSGIGVSASKRQRSANVTDRDAKEGGGGQSGLGVMVA
EEECT
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgtcatctccggagcagcttcccgcgctctcagcgggggggtcaccgtcgtcgggaggg
gcttcctcgcatcactcaccgcacgaagcatcgctcccgtttcccgcttcggcgattacc
ggcgacgcctctgcggagtctccgcgcgcgtcgtcggtgccaccgtcttcaacagcaagc
gaggagagcgcagcaacatcgccactggagcgaaagccagatgcagcggcgtcacgccct
gggagacggaaggtggtgtactttgtagatcactccgtcactgccatagcctatgcggag
ggtcatttgatgcggccgtctcgtgtgcgtgcgctgcacgcgcttgttcattccctgggc
ctcgacagtgcagaatacatgactgtgtgtcatgctcgtccggcgacggcggaggagatg
ggggcgtttcaccgcagcgcgtacttggaatgcctgcggcaggcacccgtgatttgcggg
aatccgctggacgagatatccctagcttttcagaaggaatttgacgtcccgttcgcgtct
cagaacggcgactgtcctctctttcctgaggtgtgggcgctggtgtccagccaagccggc
gcctcgcttgcctgtgcagaggcccttgtacgcggcgatgccacggtggcgatgaactgg
gcaggtggcatgcatcacgccgctgccgcccacgcaagcgggttctgctttgtgaatgac
attgtgttgtgcatccgccggctgctgcggcactaccagcgcgtcctctacgttgacctt
gacgtgcatcacggggacggcgtggagggggccttttacggcaatcaccgcgtgatgacg
ctctcgctgcaccagttcggcaacggcttcttccccggcaccggtgactacccgacgcgt
gagacggccgacagcttcgccatcaacgtcccgctgcccacgcgcacgggagacgccgcg
tacctcttgtcgttccgcactgcactgtccagcgtggttcagtgctttgatccggaggcg
atggtcgtgcaatgcggcgcggacaccatagcgggagacctcattgggcggctttgcgtg
actacattggcgcacacgcagtgtgtggcagatgtgctgtcgcttgagcgaccgacggta
ctgcttggtggagggggttatcacgtgtttcacacggcgcgctgctgggcgatccacacc
gccaccgcgctaggtcgcacagctgcgcagttgcccttgtacatcccgcgcacagacccc
tactatatggattaccggcgcgaatgcacaccgaagcgtccgacgctgcatgtgtttctc
gaccctgacgtcgatgatccgctgccgttgggggacagcttggcgttctggcgtcagctc
tgtcgcagcatccagtggcagatgcgcactgcccgccttgtgcggcaggggttttctcgt
acagtacagctttgccggcagcgaagggcagcgttgctgaggcagttcgctacgcaagag
gcagggagggactcgggtatcggtgtcagcgcctctaagcgccagcggtcagcaaatgta
acggaccgcgatgccaaggaggggggcggaggacagagtggtctcggcgtgatggttgcg
gaggaggagtgcacttag

DBGET integrated database retrieval system