KEGG   Leishmania mexicana: LMXM_24_2250Help
Entry
LMXM_24_2250      CDS       T02288                                 

Definition
putative fatty-acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
lmi  Leishmania mexicana
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:lmi01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:lmi01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
24
AA seq 431 aa AA seqDB search
MTSVEKKGKDMTEETARRQPTYQEGNYEINYVAVAVLGLPIAGVLAAVFMGVPLQWKTFV
TAVLFYMFNGCLGVTVGYHRLFSHRSYTASTAFQWLCAFAGAGSFEGSAKWWARNHRIHH
RYVDTEKDPYNAQRGFIFSHMGWMIMKQDYSLLGKVDVSDFKYNYVIQFQHKHFFKMAML
SGVILPTVICGLGWGDWLGGYFYAALAKIVFVHHCTFFINSLAHTNLFAAVQNYSDRHSS
HDSFVCALFTFGEGYHNFHHEFAQDYRNGIKWYHYDPTKWIIRAVSFLGGAKNLVRTPND
VIDANFNKMLLKKSKKAMEQAQTRLGQLDIPISAEWTWEKVQDEVAKGRKLTVINNEVID
LMRSIQTGAGYTHNSKDVIWYSNHPGGQRILDMFVGKDATSAFTGGVYAHSCGAESYLQQ
LRVAKLKVVTD
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgacctcggtggagaagaagggtaaggacatgacggaggagactgcgcgccgtcagccc
acgtaccaagagggcaactatgagatcaactatgttgccgtggctgtcctgggccttccc
atcgctggcgtactcgctgccgtgttcatgggcgtgccactgcagtggaaaacgtttgtc
accgccgtacttttttacatgttcaatggttgcctcggcgtcaccgttggctaccaccgt
ctgttctcgcaccgctcatacacggcctccactgcgttccagtggctgtgcgctttcgct
ggcgccggctctttcgaaggctcggccaagtggtgggcccgcaaccaccgcattcaccac
cgttatgtggacacggagaaggacccctacaacgcgcagcgtggcttcattttctcgcac
atggggtggatgatcatgaagcaggactattccctgctcggcaaggtggacgtgtcggac
ttcaagtacaactacgtgatccagttccagcacaagcacttttttaagatggcgatgcta
tccggtgtcatcctacccacggtgatctgcggcctcggctggggtgactggcttggtggg
tacttctacgccgctctcgcgaagatcgtgttcgttcaccactgcaccttcttcatcaac
agcctggctcacacgaacctcttcgctgcggtgcagaactactcggaccgccactcgtcg
cacgactccttcgtgtgcgcgctgttcacttttggtgagggctatcacaacttccaccac
gagtttgcccaggactaccgcaacgggatcaagtggtatcactacgaccccaccaagtgg
atcatccgcgcggtgtcgtttctcggcggtgccaagaacctcgtgcgcacgccgaacgat
gtcatcgatgctaacttcaacaagatgctgctgaagaagtcgaagaaggcgatggagcag
gcacagactcggctaggccagctcgacatccccatctctgcggagtggacttgggagaaa
gtccaggatgaagtggctaagggccgcaagctgacggtcatcaacaacgaagtgattgac
ctgatgcgcagcattcagaccggcgctggctacacgcacaacagcaaggacgtcatctgg
tactcgaaccaccccggcggccagcgcatcctggacatgttcgttggcaaagacgcaacg
tcggcgttcactggtggggtgtacgctcactcgtgcggcgccgagtcctaccttcagcag
ctgcgcgttgcgaagctgaaggtagtgaccgattaa

DBGET integrated database retrieval system