KEGG   Leishmania mexicana: LMXM_24_2250Help
Entry
LMXM_24_2250      CDS       T02288                                 

Definition
(RefSeq) putative fatty-acid desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
lmi  Leishmania mexicana
Pathway
lmi01040  Biosynthesis of unsaturated fatty acids
lmi01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:lmi00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    LMXM_24_2250
Enzymes [BR:lmi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     LMXM_24_2250
Lipid biosynthesis proteins [BR:lmi01004]
 Desaturase
  First
   LMXM_24_2250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase Cyt-b5 DUF5467
Motif
Other DBs
NCBI-GeneID: 13454494
NCBI-ProteinID: XP_003876043
UniProt: E9AX71
Position
24
AA seq 431 aa AA seqDB search
MTSVEKKGKDMTEETARRQPTYQEGNYEINYVAVAVLGLPIAGVLAAVFMGVPLQWKTFV
TAVLFYMFNGCLGVTVGYHRLFSHRSYTASTAFQWLCAFAGAGSFEGSAKWWARNHRIHH
RYVDTEKDPYNAQRGFIFSHMGWMIMKQDYSLLGKVDVSDFKYNYVIQFQHKHFFKMAML
SGVILPTVICGLGWGDWLGGYFYAALAKIVFVHHCTFFINSLAHTNLFAAVQNYSDRHSS
HDSFVCALFTFGEGYHNFHHEFAQDYRNGIKWYHYDPTKWIIRAVSFLGGAKNLVRTPND
VIDANFNKMLLKKSKKAMEQAQTRLGQLDIPISAEWTWEKVQDEVAKGRKLTVINNEVID
LMRSIQTGAGYTHNSKDVIWYSNHPGGQRILDMFVGKDATSAFTGGVYAHSCGAESYLQQ
LRVAKLKVVTD
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgacctcggtggagaagaagggtaaggacatgacggaggagactgcgcgccgtcagccc
acgtaccaagagggcaactatgagatcaactatgttgccgtggctgtcctgggccttccc
atcgctggcgtactcgctgccgtgttcatgggcgtgccactgcagtggaaaacgtttgtc
accgccgtacttttttacatgttcaatggttgcctcggcgtcaccgttggctaccaccgt
ctgttctcgcaccgctcatacacggcctccactgcgttccagtggctgtgcgctttcgct
ggcgccggctctttcgaaggctcggccaagtggtgggcccgcaaccaccgcattcaccac
cgttatgtggacacggagaaggacccctacaacgcgcagcgtggcttcattttctcgcac
atggggtggatgatcatgaagcaggactattccctgctcggcaaggtggacgtgtcggac
ttcaagtacaactacgtgatccagttccagcacaagcacttttttaagatggcgatgcta
tccggtgtcatcctacccacggtgatctgcggcctcggctggggtgactggcttggtggg
tacttctacgccgctctcgcgaagatcgtgttcgttcaccactgcaccttcttcatcaac
agcctggctcacacgaacctcttcgctgcggtgcagaactactcggaccgccactcgtcg
cacgactccttcgtgtgcgcgctgttcacttttggtgagggctatcacaacttccaccac
gagtttgcccaggactaccgcaacgggatcaagtggtatcactacgaccccaccaagtgg
atcatccgcgcggtgtcgtttctcggcggtgccaagaacctcgtgcgcacgccgaacgat
gtcatcgatgctaacttcaacaagatgctgctgaagaagtcgaagaaggcgatggagcag
gcacagactcggctaggccagctcgacatccccatctctgcggagtggacttgggagaaa
gtccaggatgaagtggctaagggccgcaagctgacggtcatcaacaacgaagtgattgac
ctgatgcgcagcattcagaccggcgctggctacacgcacaacagcaaggacgtcatctgg
tactcgaaccaccccggcggccagcgcatcctggacatgttcgttggcaaagacgcaacg
tcggcgttcactggtggggtgtacgctcactcgtgcggcgccgagtcctaccttcagcag
ctgcgcgttgcgaagctgaaggtagtgaccgattaa

DBGET integrated database retrieval system