KEGG   Leishmania mexicana: LMXM_25_0190Help
Entry
LMXM_25_0190      CDS       T02288                                 

Definition
cysteine peptidase, Clan CA, family C12,putative
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
lmi  Leishmania mexicana
Brite
Enzymes [BR:lmi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     LMXM_25_0190
Peptidases [BR:lmi01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   LMXM_25_0190
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
25
AA seq 233 aa AA seqDB search
MWFPLESNPQVMNRYISTLGLTDAKVQFVDVYGVSDDLLEMVPSPVHAVLLVYPMCEATE
KRLAEQQAAQTEEVAALRKVHPFFFTHQLVSNACGTIAIAHALMNNRDKLGEIAAGSILD
GPWVKAAEMSQDPKIIGKLIAEDTSLASAHAAAAQEGTTANQHIDADINLHFVCFIPVGG
RCVELDGRKANPTLHGHCTDNKSFLTAAAAAIQKRIELNPNSYEFGITALVNK
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgtggttcccgctggagagcaatccgcaggtgatgaaccgctacataagcaccttgggt
ctcacagatgccaaggtgcagtttgtggatgtgtacggtgtgtcggacgatctacttgaa
atggtgccttccccggtgcacgccgtgctcctcgtgtacccaatgtgcgaggccacggag
aaacgcctagctgagcagcaggctgcgcagacagaggaagttgctgcacttcgaaaagtg
caccctttcttctttacacaccagctcgtttcgaacgcgtgcggaactattgccatcgcg
catgctctcatgaacaaccgcgataagctcggtgagatcgccgccggcagtatcctcgac
ggcccatgggtgaaggcggcagagatgtcgcaagatcccaagatcatcgggaaacttatt
gccgaagacacgagtctcgccagcgctcacgccgctgctgcgcaggagggcacgaccgcc
aaccagcatatcgacgcggacatcaaccttcactttgtctgcttcatccccgtgggcgga
cgctgcgtcgagctggatgggcgcaaagccaacccaaccttgcacggtcactgcaccgac
aacaagtctttcctcacggcggcagccgctgctatacagaaacgcatcgagctcaacccg
aactcctacgagttcggcatcaccgcactcgtgaacaagtga

DBGET integrated database retrieval system