KEGG   Leishmania mexicana: LMXM_25_2120Help
Entry
LMXM_25_2120      CDS       T02288                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
lmi  Leishmania mexicana
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:lmi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    LMXM_25_2120
Translation factors [BR:lmi03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    LMXM_25_2120
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
25
AA seq 212 aa AA seqDB search
MDDYHDDDVHSNYGYEDDEYDDAADDWEAEAAEEEQRAIAEEAARQARLEKKLATRAPVK
KEEEEEAVPEDVECAIADMRQMANDIASGSTLLSGGDSEELIGNHKLASDADVDRVGTMI
ADRLTSFSHSAHYDKLIVEVFQRLTNHLTSTHLLNEEADRVHRLREELKRAAKAKPKPVE
TAPVTQSGLNLDNFEDRGGAAVAEENEDETGW
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggacgactaccacgacgatgatgtgcacagcaactacggatatgaggatgacgagtac
gacgacgccgccgatgactgggaagctgaggccgcagaggaggagcagagggccatcgcc
gaggaggctgctcgacaggcccgcttggaaaaaaagctggccacacgtgccccggtaaag
aaggaagaggaggaggaggcagtgccagaggacgtggagtgcgcgattgcagacatgcga
cagatggccaacgacatcgcctcgggtagtacccttctctccggaggagattcggaggag
ctgattgggaaccataagctggcttcggacgcggatgttgaccgggtaggcaccatgatt
gcagaccgcctcacgtccttttcgcactccgcccactacgacaagctgatcgtcgaagtt
tttcaacgcttgaccaaccacctgacgagcacgcatctcctgaacgaggaggcggacagg
gtacaccgtctgcgcgaggagctcaagcgtgcggcgaaggcaaagccgaagccggtagag
acggcgcctgttacacagagcggcctcaatctcgataactttgaggacagaggtggtgcc
gccgtcgctgaggagaacgaggacgagacgggctggtag

DBGET integrated database retrieval system