KEGG   Leishmania mexicana: LMXM_26_0660Help
Entry
LMXM_26_0660      CDS       T02288                                 

Definition
putative protein disulfide isomerase
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
lmi  Leishmania mexicana
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:lmi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    LMXM_26_0660
Enzymes [BR:lmi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     LMXM_26_0660
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
26
AA seq 379 aa AA seqDB search
MTRQLSVVLTLALVLAVFVLAGSCNGEDPGAVTPGVVQMSKDNFDQLVGKDKAALVEFYA
PWCGHCKSMAPEYAVLGAAYEASTNAKDLLLIGKVDATQESDLGKRFGVTGFPTLLYFAP
GSLKPEKYQGSRTAEDFAKYLSGVVAGLRLTIPNEPQFAMELVHTNFDAVAKDPSKSVLV
MFYAPWCGHCKALKPTYNKLAKVFSNDKDVVIARINADDAANRKIATEYSVSGFPTLYFF
PKGADTKPAEYRNGRNLEDFLTFVNEKAGKHRLANGDLSWEYGVIAELAEAVARVAMSSG
ESSKAAVEAVKAAAAKLTGSEDAAYYIKTAERIAVKGPAYLENESARLKRTLGGSVAGGR
RDNMMMRLNILTSIQKHVK
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgccagcttagtgttgtgctgacgctcgcgctcgtgctcgcggtcttcgtgctc
gcggggtcgtgcaacggcgaagacccgggtgctgtgacgccgggtgtcgtgcagatgagt
aaggacaactttgaccagctcgttggcaaggacaaggcagcactcgtggagttttacgcg
ccgtggtgtggccactgcaagagcatggcccccgagtacgcggtgctaggcgcggcctac
gaagcgagcacgaacgccaaggacttgctgctgattggcaaggtggacgccacgcaagag
agcgaccttggcaagcgcttcggcgtcacggggttcccaacacttctctacttcgctcct
ggctcattgaagccggagaagtaccagggcagccgcacggccgaggacttcgccaagtac
ctctcgggtgtggtggcgggcctgaggctgaccatcccgaatgagccccagtttgcgatg
gagctggtgcacacgaatttcgatgcagtcgccaaggacccgtccaagtcggtgctcgtc
atgttctacgccccgtggtgcggccactgcaaggcgctgaagccgacgtacaacaagctg
gccaaggtgttctcaaacgataaggatgttgtgattgcccgcatcaacgccgacgatgcc
gcgaaccgaaaaattgccaccgagtactctgtgtccggttttccgacactgtacttcttt
cccaaaggcgccgacacgaagccggccgagtacaggaatggccgcaacctggaggacttc
ctcaccttcgtgaacgagaaagccggcaagcaccgcctcgctaacggagacctctcatgg
gagtacggggttatcgcagagctcgcggaggcggtcgcgcgcgtggcgatgagctctggc
gagagctccaaggcagcagtagaggcggtgaaggcggccgctgccaagctgaccgggagc
gaagacgccgcgtactacattaagacggcggagcgcattgcggtgaagggccccgcgtac
ttggagaatgaatcggctcgcctcaagcgcaccctcggaggctctgtggcgggcggtcgc
cgtgataacatgatgatgcgcctgaatattctgacctcgatccagaagcacgtgaagtag

DBGET integrated database retrieval system