KEGG   Leishmania mexicana: LMXM_27_0420Help
Entry
LMXM_27_0420      CDS       T02288                                 

Definition
putative ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lmi  Leishmania mexicana
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lmi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LMXM_27_0420
Enzymes [BR:lmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     LMXM_27_0420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
27
AA seq 329 aa AA seqDB search
MHRVQKVQSHAGEYAPDILVVGSCFLDYVGYVDHMPQVGETMHSESFHKGFGGKGANQAV
AAGRLGAKVAMVSMVGTDGDGSDYIKELERNGVNTAHMLRTGKSSTGLAMILVDTKSSNN
EIVICPNATNHFTPELLRAQTSNYERIMHAGLKYLICQNEIPLSTTLDTLKEAHSRGVYT
VFNSAPAPKPAEVEQIKPFLPYVSLFCPNEVEATLITGVKVTDTESAFRAIKALQQLGVR
DVVITLGAAGFVLSENGAAPVHVTGKRVKAVDTTGAGDCFVGSMVYFMSRGRNLLEACKR
ANECAAISVTRKGTQLSYPYPSELPAGAM
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgtgtgcagaaggttcaatctcatgcgggcgagtatgccccagacattttggtg
gttggctcctgctttctggactatgttggctacgtggaccacatgccgcaggtgggcgag
acgatgcactcggagtcgtttcacaagggatttggcggtaaaggcgccaaccaagctgtg
gcggctggccgcctgggggccaaggtcgccatggtgagcatggtcgggacagatggcgac
ggcagtgactacatcaaggagctggagaggaacggtgttaacacggcgcacatgcttcgc
accggcaagagctcgactgggctggcgatgatcctggtcgataccaagtcgtccaacaac
gaaattgtcatttgtcccaacgccacaaaccacttcacacctgagctgcttcgcgcgcag
acgagcaactacgagaggatcatgcacgcggggctcaagtatctcatttgccagaacgaa
atacccctctccaccacgctcgatacactgaaagaggcgcacagccgtggcgtgtacacg
gtgttcaacagcgctccggccccgaagccggctgaggtggagcagatcaagccgtttctc
ccctacgtgtcgctcttctgtccaaacgaagtagaggctacgctcatcactggcgtgaag
gtgacggacaccgagtccgcctttcgcgccatcaaggcgctgcagcagctcggcgttcgt
gatgtcgtcatcacgctcggtgcggccggctttgttctttctgaaaatggtgccgcgccg
gtgcatgtcacgggcaagcgcgtcaaggcggtggacacgaccggcgccggtgactgcttc
gtcggctccatggtgtattttatgagtcgcggccgaaaccttctggaggcctgcaagcga
gccaacgagtgcgccgccatcagcgtcacgcgcaagggcacacagctgtcctacccgtac
ccaagtgagctgccagctggtgccatgtag

DBGET integrated database retrieval system