KEGG   Leishmania mexicana: LMXM_27_1620Help
Entry
LMXM_27_1620      CDS       T02288                                 

Definition
eukaryotic translation initiation factor eIF-4E,putative
Orthology
K03259  
translation initiation factor 4E
Organism
lmi  Leishmania mexicana
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:lmi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    LMXM_27_1620
Translation factors [BR:lmi03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    LMXM_27_1620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
27
AA seq 213 aa AA seqDB search
MSSPSSVPPNKMANLHKLQRAWTLWYDSPSTYNTENWEMSLVPIMTVHSVEEFFVMLRYM
KPLHALRTSSQYHLFQEGVKPMWEDPANKKGGKLWVNLDITSANGRSSNNASGTAAADGS
AAEAKTDLDKAWENVLMATVGEYLDCVEKKDTSAEPFVTGIVMSKRKYHNRLAVWVSDAS
ATDKIEALKKTLTKEASLAPIASIVFTKHGEAS
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgtcatctccatcttcagttcctcccaacaaaatggcgaatttgcacaagctgcagcgc
gcctggacactctggtacgatagcccgtctacgtacaacactgaaaactgggagatgtcg
ttggtgcccatcatgaccgtgcactccgtggaggagttcttcgtcatgctcaggtacatg
aagcctctgcatgccttgcgcacctcctcgcagtaccacctcttccaggaaggcgttaag
ccgatgtgggaggacccggccaacaagaagggcggcaagctctgggtgaaccttgatatc
accagcgccaatggtcggagcagcaacaatgccagcggtaccgcggcagccgatggcagc
gcggcggaggccaagacggacctcgacaaggcgtgggagaatgttctgatggccaccgta
ggcgagtatctcgactgtgtagaaaagaaggacacatcagcggagccgttcgtgacgggc
attgtcatgtcaaagaggaagtaccacaaccgcctcgccgtgtgggtgagcgatgcgtcc
gcaacggacaagatcgaggcgctaaagaagacgctgacaaaggaggcgagcctggcgccg
attgcatccattgtcttcacaaagcacggcgaggcgtcttaa

DBGET integrated database retrieval system