KEGG   Leishmania mexicana: LMXM_28_1240Help
Entry
LMXM_28_1240      CDS       T02288                                 

Definition
putative p450 reductase
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
lmi  Leishmania mexicana
Brite
Enzymes [BR:lmi01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     LMXM_28_1240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
28
AA seq 645 aa AA seqDB search
MSFLYIVATVLFALAGYFYFQLNRQASGRYGAVSATTNPNGKKAPGVSDAAASGSDAVAK
NEKEVTVLFGSQTGTAEMFAKTLTREGTKLGVPIKVCDVDCYEAYNMEYERLVILICATY
GEGEPTDTMKNFHDWMMDECRSPGEELANVKYAVFGLGDRQYNYFCEEGIVMDSRFEELG
AQRIFGLGCGDSGNGQLEEQFDEWCKDLWPAVGRALNITIKDNSEEPVEPQCRIKYWEEA
EEPLAFPKTTSVLEPTQRLPVWVPIIRNEELLRKTEGHSTRAIEFSISGTIISYQAGDHL
GILPCNPDELVSQYLQSLGISDEEACRVFSLQEKRTLKNVLPTRVSMRTALKWYIDLTGP
PKKSTLRAFAHCCTDPVQKEELLRILRVNPDAQREFAKLCGKLRTMLGFLRKFNSAKVPQ
SFFLELMPRIAPRYYSISSDLLATPTLVGTTVGIIDGGLCTNMLARMQVGDKVPVFVRKS
NFHLPLRHKERPVVMIGAGTGVAPFIGFIARRGVWKQKGTELGKSILFFGCRRHDEDHIF
EDYCTEAVHEGVLSALVTAYSRDQAHKVYVQHRLRERGAEIWEMLVSGANVYICGDSRRM
AKDVEAELKRIVEVEGKMSREAATEHIRAMEKEGRYLKDVWSSAL
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttcctctacattgtcgccacggtgctgttcgccttggctggctatttctacttc
cagctgaaccggcaggcttccgggcgctatggcgctgtgtctgccaccaccaatcccaat
ggcaagaaggcgcctggcgtgagcgacgccgctgccagcggcagtgacgcagttgcgaag
aacgaaaaggaggtcactgtcctgtttggatcgcagacaggcacggctgagatgtttgcc
aagacgctgactcgcgagggtacgaagctcggtgtgcctatcaaggtatgcgacgtcgac
tgctacgaggcgtacaacatggagtacgagcgccttgtcattctaatatgcgccacctac
ggcgagggcgagccgactgacacaatgaagaacttccacgactggatgatggacgagtgc
cgctcgccaggggaggagctggcgaatgtgaagtacgccgtgttcggcctgggtgatcgt
cagtacaattacttctgcgaggagggtatcgtcatggatagccgcttcgaggagctcggg
gcgcagcgcattttcggccttggctgcggcgactcgggcaacgggcagctggaggaacag
ttcgatgagtggtgcaaggatctctggcccgctgtcgggcgtgctctgaacatcactatc
aaggataactcggaagagcccgtggagccacagtgtcgaatcaagtactgggaggaggcc
gaggaaccgcttgcgttccccaagacgacttccgtgctggagccaacgcagcgcctgccg
gtgtgggtgcccatcatccgcaacgaagagctgctgcgcaagaccgaggggcacagcacc
cgcgccatcgagttcagcatcagcggcaccatcatctcctaccaagccggtgatcacctc
ggcatcctgccgtgcaacccggatgagcttgtctcacagtacctgcagtccctcggcatc
tccgacgaggaagcctgccgcgtcttctctctgcaggagaaaaggacgctcaagaacgtc
ctcccaactcgtgtgtcgatgcgcacggcgcttaagtggtacatcgacctcaccggaccc
ccgaagaagtcgacgctgcgcgcctttgctcactgctgcaccgaccccgtgcagaaagag
gagctgctgcgcattctgcgcgtgaacccggacgcacagagggagttcgcgaaactatgc
ggtaagctgcgcacgatgctaggcttcctgcgcaagttcaactctgccaaggtgccgcag
tcctttttcctcgagctcatgccgcgcatcgcgccccgctactactctatctcctccgac
ctccttgccacaccgaccttggtggggacgacggtcggcattatcgatggtggtctgtgc
acgaacatgctggccaggatgcaggtgggcgacaaggtgcccgtgtttgtgcgcaagtcc
aacttccacctcccgttgcggcacaaggagcggccggtggtgatgattggcgccggcacc
ggtgtggcaccattcatcggcttcattgcgcgccgtggggtctggaagcagaaaggcact
gaactcggcaagtccatcctcttctttggctgccgccggcatgacgaggatcacatcttc
gaggactactgcacggaggcggtgcacgaaggggtcctgtcggcgctggtgaccgcgtac
agtcgcgaccaagcccacaaggtgtacgtccagcaccggctgagggagcggggggcggag
atatgggaaatgttggtatcgggcgcgaatgtctacatctgcggtgactcgaggcgcatg
gccaaggacgtggaggcggagctcaaacgcattgtggaggtggagggcaagatgtcgcgc
gaggccgctaccgagcacatcagagcgatggaaaaggaggggcggtacctaaaggatgtg
tggtcgtcggccttgtag

DBGET integrated database retrieval system