KEGG   Leishmania mexicana: LMXM_28_2420Help
Entry
LMXM_28_2420      CDS       T02288                                 

Definition
putative 2-oxoglutarate dehydrogenase, E2 component,dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
lmi  Leishmania mexicana
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lmi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LMXM_28_2420
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LMXM_28_2420
  Amino acid metabolism
   00310 Lysine degradation
    LMXM_28_2420
Enzymes [BR:lmi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     LMXM_28_2420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
28
AA seq 389 aa AA seqDB search
MFRRVSTRVLPTACSAAHNVSLRFCISINVPTIAESISTGKVVNWTKKVGDAVAEDEVIC
QIESDKLNVDVRAPTNGVITKINFDDGADVEVGAELSTMKEGPAPAAAAPKAAEVKLDAP
KAEPPKAATPAAAAPAAPAVPVAAAKPAMHTIAGADPRTKSVRISSMRRRIADRLKASQN
TCAMLTTFNEIDMTPLFQLRDKYKDEFHKRHDVKLGLMSPFVKASAIALKDVPIVNASFG
KDTIDYHEFVDIAIAVATPRGLVVPVIRDVQSMNLANIETAIADYAARARINKLTMAEMT
GGTFTISNGGVFGSWMGTPIINPPHSAILGMHAIKKKPWVVGNEIKIRDIMAVALTYDHR
LIDGSDAVTFLVKVKNLIEDPARMVLDLS
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgtcgtgtgtcgacgcgtgtgttgcccactgcgtgcagtgcggcccataacgtg
agcctgcgcttctgcatcagcatcaacgtacccacgattgccgagtccatcagtacgggt
aaggttgtgaactggacgaagaaggtcggcgatgccgtcgcagaggacgaagtaatttgc
cagatcgagtctgacaagcttaacgtcgacgtgcgtgcgccgacgaatggcgtcattacg
aagatcaatttcgatgatggcgcggatgtcgaggtcggcgcggagctgtccacgatgaag
gagggccccgcaccagcggcagctgcaccgaaggctgcggaagtcaagttggacgcaccc
aaggcggagccgccgaaggcggcaaccccagctgctgcggcgcctgccgctcctgccgta
cctgtggccgccgccaagcccgcgatgcacaccattgccggcgctgacccgcgcacgaag
agcgtccgcatctcctcgatgcgccgccgcatcgccgaccgcctcaaggccagccagaac
acgtgcgcaatgctcaccaccttcaatgaaatcgacatgacaccgctgttccagctgcgc
gacaagtacaaggacgagttccacaagcgccacgacgtgaagttggggctgatgtcgccc
ttcgtgaaggcgagcgcgattgcgctcaaggacgtaccgatcgtgaacgcgtcctttgga
aaggacaccatcgactaccacgagttcgtagatatcgcgatcgccgtggcgacgccgcgc
ggcctcgtcgtgcccgtaatccgtgatgtgcagagcatgaatttggcaaacatcgagacc
gccatcgccgactacgccgcgcgtgcgcgcatcaacaagctgaccatggctgagatgact
ggaggcaccttcaccatctccaacggcggcgtcttcgggtcttggatgggcacgccgatc
atcaacccgccgcatagcgccatccttggcatgcacgccatcaagaaaaagccgtgggtg
gtgggtaacgagatcaagatccgcgacatcatggcagtcgctctgacctacgaccaccgc
cttatcgacggtagcgacgcggtgaccttcctcgtgaaggtgaagaatctgattgaggac
ccggcgcgtatggtgctggacctctcgtag

DBGET integrated database retrieval system