KEGG   Leishmania mexicana: LMXM_29_0370Help
Entry
LMXM_29_0370      CDS       T02288                                 

Definition
putative mitogen-activated protein kinase
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
lmi  Leishmania mexicana
Brite
Enzymes [BR:lmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     LMXM_29_0370
Protein kinases [BR:lmi01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   LMXM_29_0370
Exosome [BR:lmi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   LMXM_29_0370
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
29
AA seq 410 aa AA seqDB search
MILTKVEGPNAAGNKVYVFGVNDYRLEVPECYNVQHFVGRGAYGFVCSAVDTVTNEPVAI
KKVTHLFDDAVDAKRVLREVKLLAYLNHPNILSLKDLFKSPDPVDTYSELYVVTDLMESD
MDAVLRSPRIRLAAGHGQYFTLQLLCALQYIHSAHVLHRDLKPGNLLTDSECNLKLGDFG
LARGIGHDDTMTQYVFTRWYRPPELLLVCKHCSYSADMWAVGCLAAEMFTGKPLFPGKDY
INQINLIVELLGIPDLARDLPPSTSKEAVHYLSSLPPSKGKKLEEYAPELRHRFDETTFY
DSFDTELEEAIAADGATIARPKPRPPEEYYAEFVDFIFGLLRYNPVKRRTAKESIAHAWL
SDVRGPQETIGGCEAERIYRWDADGTAFTIPQLRQLFIDEIEKFASTRRN
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgatactcacgaaggtggagggccctaatgcggctggcaacaaggtttacgtctttggt
gtgaacgactatcgccttgaggtaccagagtgctacaatgttcaacactttgttgggcgt
ggcgcctacggctttgtgtgcagcgctgtggacacggtgacgaatgagccagtggcgatc
aagaaggtgacgcacctcttcgacgatgccgtcgatgcaaagcgcgtcctgcgagaggtg
aagctgttagcctatctcaatcacccgaacatcctctccctcaaggacctcttcaagtca
ccggacccggtcgacacgtacagcgagctctacgttgtgaccgacttgatggagtcggac
atggacgccgtcctgcgttccccacggatccgtctcgccgccgggcacggacagtacttc
acccttcagttgctgtgcgcactgcaatatattcacagtgcgcatgtgctgcaccgagac
ctgaagccgggaaacctgctgacagactcggagtgcaaccttaagctgggcgactttggc
ctcgcgcgcggtatcgggcatgacgacaccatgacacagtacgtgttcacgcggtggtac
cggccaccagagttgctgctggtgtgcaagcactgcagctacagcgctgacatgtgggct
gtgggatgccttgcggcggagatgttcaccggcaagccgctcttccctggcaaggactac
atcaaccagatcaacctcatagtggagttattaggcataccggaccttgcacgtgaccta
ccgccgagcacgtcaaaggaggcggtacactacctctcctccctgccccctagcaagggg
aagaagctcgaggagtacgcaccggagctgcggcatcgctttgacgagaccaccttttac
gacagcttcgacacggagttagaggaggcgatcgctgcggatggcgccaccatcgcccgc
cctaagccacgcccgccggaggagtactacgccgagttcgtcgacttcatctttggactg
cttcgttacaaccccgtgaagcggcgcacggcgaaagagtccatagcgcatgcgtggctg
tcggacgtgcgcggtccacaggagaccattggcggctgcgaggcggagcgaatataccgt
tgggatgccgacggcaccgctttcaccatcccgcaacttcgccaactgttcatagatgag
atcgaaaagtttgcgtcaacccggcgcaactga

DBGET integrated database retrieval system