KEGG   Leishmania mexicana: LMXM_29_0370Help
Entry
LMXM_29_0370      CDS       T02288                                 

Definition
(RefSeq) putative mitogen-activated protein kinase
Organism
lmi  Leishmania mexicana
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
29
AA seq 410 aa AA seqDB search
MILTKVEGPNAAGNKVYVFGVNDYRLEVPECYNVQHFVGRGAYGFVCSAVDTVTNEPVAI
KKVTHLFDDAVDAKRVLREVKLLAYLNHPNILSLKDLFKSPDPVDTYSELYVVTDLMESD
MDAVLRSPRIRLAAGHGQYFTLQLLCALQYIHSAHVLHRDLKPGNLLTDSECNLKLGDFG
LARGIGHDDTMTQYVFTRWYRPPELLLVCKHCSYSADMWAVGCLAAEMFTGKPLFPGKDY
INQINLIVELLGIPDLARDLPPSTSKEAVHYLSSLPPSKGKKLEEYAPELRHRFDETTFY
DSFDTELEEAIAADGATIARPKPRPPEEYYAEFVDFIFGLLRYNPVKRRTAKESIAHAWL
SDVRGPQETIGGCEAERIYRWDADGTAFTIPQLRQLFIDEIEKFASTRRN
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgatactcacgaaggtggagggccctaatgcggctggcaacaaggtttacgtctttggt
gtgaacgactatcgccttgaggtaccagagtgctacaatgttcaacactttgttgggcgt
ggcgcctacggctttgtgtgcagcgctgtggacacggtgacgaatgagccagtggcgatc
aagaaggtgacgcacctcttcgacgatgccgtcgatgcaaagcgcgtcctgcgagaggtg
aagctgttagcctatctcaatcacccgaacatcctctccctcaaggacctcttcaagtca
ccggacccggtcgacacgtacagcgagctctacgttgtgaccgacttgatggagtcggac
atggacgccgtcctgcgttccccacggatccgtctcgccgccgggcacggacagtacttc
acccttcagttgctgtgcgcactgcaatatattcacagtgcgcatgtgctgcaccgagac
ctgaagccgggaaacctgctgacagactcggagtgcaaccttaagctgggcgactttggc
ctcgcgcgcggtatcgggcatgacgacaccatgacacagtacgtgttcacgcggtggtac
cggccaccagagttgctgctggtgtgcaagcactgcagctacagcgctgacatgtgggct
gtgggatgccttgcggcggagatgttcaccggcaagccgctcttccctggcaaggactac
atcaaccagatcaacctcatagtggagttattaggcataccggaccttgcacgtgaccta
ccgccgagcacgtcaaaggaggcggtacactacctctcctccctgccccctagcaagggg
aagaagctcgaggagtacgcaccggagctgcggcatcgctttgacgagaccaccttttac
gacagcttcgacacggagttagaggaggcgatcgctgcggatggcgccaccatcgcccgc
cctaagccacgcccgccggaggagtactacgccgagttcgtcgacttcatctttggactg
cttcgttacaaccccgtgaagcggcgcacggcgaaagagtccatagcgcatgcgtggctg
tcggacgtgcgcggtccacaggagaccattggcggctgcgaggcggagcgaatataccgt
tgggatgccgacggcaccgctttcaccatcccgcaacttcgccaactgttcatagatgag
atcgaaaagtttgcgtcaacccggcgcaactga

DBGET integrated database retrieval system