KEGG   Leishmania mexicana: LMXM_29_2950Help
Entry
LMXM_29_2950      CDS       T02288                                 

Definition
phospholipase c-like protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
lmi  Leishmania mexicana
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:lmi00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    LMXM_29_2950
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    LMXM_29_2950
Enzymes [BR:lmi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     LMXM_29_2950
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
29
AA seq 737 aa AA seqDB search
MPALTIGSTLPDPPKTEEELLAVQNLLSRLQASFTMRRITKRNAVRRRIVSLTSDGKALE
YKPTRKSKRQLLIFRDLYEVTKMDPASKVYRRAKLNSNTAVVVQMNTRIHRGWCIVFDDK
ASANTWMQMIGYKVKGCALAPSGAVPNEDTLTGCICATWERADMNRDGKVDLQEAKKMMV
RMNVEISDNLLTDLVRKHDASGDGALDLEEFTTLFIQLTQHEELRPLFASFAAQVDWMTR
AEFDCFLKAQGDVPSDVLFDTLMPDKSGRITFTQFMHYLLNPRLNPALDPAHQTAVVDEM
THPLKDYFINSSHNTYLSGDQFQSSSQIEMYKRALLAGCRCVELDCWDGKDNDPVIYHGH
TRTSKIRFADVIDTIRRHAFTTSPFPVILSLEVHTSDEQSMIMADHLRTILGDMLMTAKD
IPDMVYTPESLREKVLVKWKLPYNDVEDAKEGMADSVNDNDVARSQSQKAEMSAQGGLSH
LLRSCVTVGAFKTSDWGRDAEPYYIQSYVETVVKELALSHRAEFIGQTSRMMVRVYPKGT
RIGSSNYNPTTAWSVGAQLVALNYQTWDDDMRLNDGMFSLNKGCGYVLKPDYLRNPSGKA
KATPCTITVTVLSGTQIPKPSLQKKGDIADPYVKLSINKRDRTEVRTSVVRNNGLNPYWM
ETFTLACESKEIDLLTVKVMDEDTTSADDSVCEMVIPVRALRTGYRAVPMKLCKNGASLP
GASILFKFSIVDQPQES
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgccagcgttgaccatcggctcgacgctgccggaccctcccaaaacggaggaggagctg
ctggcggtgcagaaccttctctcgcgtctccaggcctccttcactatgcggcgcataacc
aaaagaaatgccgtccggcgaaggattgtttccctcacatcggacggcaaggcgcttgag
tacaagcccacgaggaagtcgaagcgtcagctactgatctttcgtgacctctacgaggtc
acgaagatggatccagcgagcaaggtgtacaggagggcgaagctgaacagcaacacggct
gtcgtcgtccaaatgaacacgcgcattcaccgcggctggtgcatcgtcttcgatgataaa
gccagtgccaacacgtggatgcagatgatcggctacaaggtgaaaggctgcgctcttgca
ccgagcggcgcggtgcccaacgaggacactctaacgggttgcatttgcgccacatgggaa
cgagcggatatgaaccgggatggcaaggtcgacttacaggaggcgaaaaagatgatggtg
cgcatgaatgtcgagatcagcgataatttgctgactgatctggtgcgcaagcacgacgcc
tcgggagacggcgcactcgacctagaggagttcacgacactgttcattcagctcacacaa
cacgaggaactgcgaccgctgttcgcgtcctttgcagcccaggtagactggatgactcgt
gccgagttcgattgctttctcaaggctcagggcgacgtccccagtgacgtccttttcgac
accctcatgcccgacaagagcggcagaatcacctttacccaattcatgcactacctgctt
aacccccgcctcaaccccgccctcgacccggcgcatcagacagcggtggtcgacgaaatg
acgcacccgctgaaggactatttcatcaactcctcgcataacacgtatctctcgggcgac
cagttccagtcctccagtcagattgagatgtacaaacgcgccctcctagcggggtgccgc
tgcgtcgagctagactgctgggacggcaaggataatgacccggtcatctatcatggccac
actcgcacctcgaagatccgctttgccgatgtcattgacaccatccgccgccacgccttc
accacctccccgtttccagtcattctctcgctcgaggtgcacacgtcggatgagcaatcc
atgatcatggcagatcacctgcgcaccatcctcggcgatatgcttatgacggccaaggac
attccggacatggtctacacgccagagtcgctgcgggaaaaggttctcgtgaagtggaag
ctgccctacaatgacgtggaggacgcgaaggaggggatggctgactcagtcaacgacaac
gacgttgctcggtcacagtcgcagaaggcggagatgagtgcgcagggggggctgtcgcac
ctgctaaggtcctgcgtcacggtgggcgccttcaaaacaagcgactggggccgggacgcg
gagccgtattacatccagagctacgtcgagactgtggtgaaggagttagcgctgagccac
cgtgccgagtttatcgggcagacctcgcgcatgatggtgcgcgtctacccgaagggcact
cgcatcggctcctcaaactacaacccgaccaccgcatggtctgtcggggcgcagttggtg
gcacttaattaccagacgtgggacgacgatatgcgcttgaacgacggcatgttctcactg
aacaagggctgcggctacgttctgaaaccggattatctgcgcaacccatcgggtaaggca
aaggcaacgccctgcaccatcaccgtcaccgtgctgagcgggacgcagattcctaagcct
tctctgcagaagaagggtgacattgctgacccgtacgtgaagctgtccatcaacaagcgc
gaccgcaccgaggtgaggacgtcagtggtgcgcaacaacggcttgaatccatactggatg
gagacgttcaccctcgcctgtgagagcaaagaaatagacttgctcactgtcaaggtcatg
gacgaggacacgacgtctgcggacgactccgtgtgtgaaatggttattccggtgcgtgca
ctgcgcaccggctaccgcgccgttcccatgaagctctgcaagaacggtgcatcgcttccc
ggggcgtctattctattcaagttcagcattgtagaccagccgcaggagtcgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system