KEGG   Leishmania mexicana: LMXM_30_0140Help
Entry
LMXM_30_0140      CDS       T02288                                 

Definition
cysteine peptidase, Clan CA, family C19,putative
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.4.19.12]
Organism
lmi  Leishmania mexicana
Brite
Enzymes [BR:lmi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     LMXM_30_0140
Peptidases [BR:lmi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   LMXM_30_0140
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
30
AA seq 456 aa AA seqDB search
MAEIKVKWGKENLTMEVDLGSTVGAFKEALKAKTGVPVEKQKLMGLKPAMNKDDATLSAA
GLVSGKTVMLIGSAESTATVPMVQATVVEANETGGYTATATTSNGLKNIANTCYLNSALQ
MMRSIPEIREVLEAYRGDNALLQQLRAVLQLLESTKDAVMPLQFWTTLVQTNPTFGERNE
HGGFMQQDSQEVLNMLLQAVNSVLPEKYAHLFEGKLHQTLTCVDDPADKGKESDVPFTML
TCNITGEVQTLEAGLEHAFDEHFTAPCEALQKDAAQFTRVSKLTEAPEYVFVHMVRFSWR
GDIQKKAKILKPITFPFTLDTTIISTEALKAAQKPVREVVRERRDKELERRRRPRTEKSS
PVDKSEEEKVPLILKNESGYYDLCGVISHKGRSADGGHYVYWGKKADTWLVYDDEHVAAV
SEEDVKRLRGVGEAHIAYVLLYRSRDPVTRTPVIPL
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaatcaaagtcaagtggggtaaggagaacctcacgatggaagtggacctgggg
agtacagtgggtgccttcaaggaggcgctcaaagccaagaccggggtgccagtggagaag
cagaagctcatgggccttaagcccgccatgaacaaggatgacgctacgctcagcgccgcc
ggcctcgtgagcggcaagacggtcatgctgattgggtcagcggagagcactgcaacggtg
cccatggtgcaggcgactgttgtagaggcgaacgagacaggtggctacaccgcgactgcg
acgacctcgaatggcttgaagaatatcgccaacacgtgctacctgaactcggctctgcag
atgatgcggagtattccggagattcgggaagtgctcgaggcgtaccgcggcgacaacgca
cttctgcagcagctccgtgccgtgctacagttgctggagagcacgaaggatgcggtgatg
ccgctgcagttctggacgacgctcgtgcagacaaatccaacgtttggtgagcgcaacgag
cacggtggtttcatgcagcaggactcgcaggaggtgctgaacatgctgctccaggccgta
aactccgtgctgcccgagaagtacgcgcacctcttcgaaggcaagctgcaccagaccctc
acctgcgtcgacgacccggctgacaagggcaaggagtccgacgttcccttcacgatgctc
acctgcaacatcaccggcgaggtgcagacgctcgaggcagggctcgagcacgccttcgac
gagcacttcaccgcaccctgcgaggccctgcagaaagacgccgcccagttcactcgcgtt
agcaagctcaccgaagcaccggaatatgtctttgtgcacatggtgcgcttttcctggcgc
ggagacattcaaaagaaggcgaagatcctcaagccgatcacgttccccttcaccctcgac
accaccatcatctccaccgaagctctcaaggcggcgcagaagccggtgcgcgaggttgtc
cgcgagcggcgcgacaaggagctggagcggcgccgccgcccccgcacagagaagtcgtcg
ccagtggacaaatcggaggaggagaaggtgcccctgatcctcaagaatgagagcggatac
tatgacctgtgcggcgtcatctcgcacaagggccgcagcgcggacggcggccactacgtc
tactggggtaagaaagcagacacgtggctcgtctacgatgacgagcacgtggcggccgtt
tcggaggaggacgtgaagcggctgcgtggtgttggagaagctcacatcgcctacgtcttg
ctatatcgcagccgcgaccccgtcacacgaacaccggttattccactttag

DBGET integrated database retrieval system