KEGG   Leishmania mexicana: LMXM_31_0520Help
Entry
LMXM_31_0520      CDS       T02288                                 

Definition
putative profilin
Orthology
K05759  
profilin
Organism
lmi  Leishmania mexicana
Brite
Exosome [BR:lmi04147]
 Exosomal proteins
  Proteins found in most exosomes
   LMXM_31_0520
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
31
AA seq 150 aa AA seqDB search
MSWQAYVEDSLIGSGYMHSAAIIGAADGSYWAYGGSYVPQPEEVQHIQKCLSDFSLVQSS
GVNIYGVKFFGLQCGTDGDCKYIFFKKGAAGGCIYTTKQAFIVAVYGNPGDTSSLQQDLE
KNTAHTVTVNPADCNTTVKRIADYLIKLGY
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggcaggcgtacgttgaagacagccttatcggtagcggctacatgcacagcgct
gctattatcggagccgctgacggcagctactgggcatacggcggcagctacgttccgcag
ccggaagaggtgcagcacatccagaagtgcttgtccgacttctcgctcgtgcagtcctct
ggtgtgaacatttacggtgtcaagttcttcggcctccaatgcggcaccgacggcgactgc
aagtacatcttcttcaagaagggtgcagccggtgggtgcatttacaccacgaagcaggca
ttcatcgttgcggtgtatgggaaccccggtgacacctcctcgcttcagcaggatcttgag
aagaacacggcccacacagtcaccgtgaaccctgcggactgcaacactacagtgaagcgc
atagcggattacctcatcaagctcggctactaa

DBGET integrated database retrieval system