KEGG   Leishmania mexicana: LMXM_31_1250Help
Entry
LMXM_31_1250      CDS       T02288                                 

Definition
(RefSeq) cysteine peptidase, Clan CA, family C19,putative
  KO
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.4.19.12]
Organism
lmi  Leishmania mexicana
Brite
Enzymes [BR:lmi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     LMXM_31_1250
Peptidases [BR:lmi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   LMXM_31_1250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
31
AA seq 409 aa AA seqDB search
MNNSNFCFMNSMLQALMFIPPFAQLSVSVSCDAQVRQLCPTLATLGKWTLQYWKPGFTRL
PMIAPMLMPRMPAGAKSSNSGAPRSAVIPTSQRILDGSVQEDAQEFLQKLLERVYEELVS
LEEAFQQADASEAATESDMGSNAPAVAASSASGDDRTDARDDATTSTFQKKGWTFVKGKE
KLAVREYEDAQGQSKLMASIFGGTLESHLQGKQRQRNRVSVLIEKYYCLPVDVGFAPECT
VEQALERTFMTERIYDSEHEQHLKKTLRLGHLPSILFLQLRRWAVTREGELVKLDNVVRI
KRTLLIPRTICGDETLGNTERTYRLLSVVCHRGDAVSRGHYVTYLVHHAATPAVLKVQSS
DPGNKDTAILRSPPDTATVILCNDANISVCPAKNMEKETMYFLVYQKTS
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgaataacagcaacttctgcttcatgaattcgatgctgcaggcactcatgtttattccc
ccctttgcgcaactgtccgtctccgtcagctgtgatgcgcaggtacgccagctgtgcccc
acactggcgactcttggaaagtggacacttcagtactggaagcccggtttcacgcggcta
ccgatgatagccccaatgttgatgccacgcatgcctgcgggcgccaagagcagtaatagc
ggcgctcctcggtcggccgtgatccccacgtcgcagcggatccttgacggctctgtgcag
gaggacgcgcaggaatttctccagaagttgctggagcgtgtgtatgaagagctggtgagt
ctcgaggaagcttttcagcaggccgacgcgtctgaggcagctacggagagcgatatgggg
tcgaatgcccctgctgtcgcggcgagcagcgccagtggtgatgaccgcaccgatgctcga
gacgacgccaccacctcgaccttccagaagaagggctggacgtttgtgaagggaaaggag
aagctggcggtgcgggagtacgaggatgcgcaagggcagtcaaaactaatggccagtatc
tttggtggcacgctggagagccacttgcaggggaagcagcgccagcgcaaccgtgtgtcg
gtgctcatcgagaagtactactgtctccccgtcgacgttggctttgcgcccgagtgtacg
gttgagcaagctctcgagcggaccttcatgacagagcgcatctatgacagcgagcatgag
cagcacctcaagaagacgctccgcctcggtcatctgccctctattctctttctgcagctg
cgccgctgggccgtgacgcgcgagggcgagctcgtgaagctcgacaacgttgtgcgtatc
aagcgcaccttgctgattccccgcaccatctgcggtgatgagaccctgggcaacacagag
cgaacgtaccgtctcttgtcagtggtgtgccaccgcggtgacgccgttagtcgggggcac
tatgtcacctacttggtgcaccacgccgcgaccccagcggtcctgaaggtgcagtcgagt
gatccgggcaacaaggacactgcgatcctgcgctcgccgcctgacacggcgacagtgatt
ctctgtaatgacgccaacatttctgtgtgtccagcaaagaacatggaaaaggagaccatg
tactttctcgtctaccaaaagacaagctga

DBGET integrated database retrieval system