KEGG   Leishmania mexicana: LMXM_31_1250Help
Entry
LMXM_31_1250      CDS       T02288                                 

Definition
cysteine peptidase, Clan CA, family C19,putative
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
lmi  Leishmania mexicana
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
31
AA seq 409 aa AA seqDB search
MNNSNFCFMNSMLQALMFIPPFAQLSVSVSCDAQVRQLCPTLATLGKWTLQYWKPGFTRL
PMIAPMLMPRMPAGAKSSNSGAPRSAVIPTSQRILDGSVQEDAQEFLQKLLERVYEELVS
LEEAFQQADASEAATESDMGSNAPAVAASSASGDDRTDARDDATTSTFQKKGWTFVKGKE
KLAVREYEDAQGQSKLMASIFGGTLESHLQGKQRQRNRVSVLIEKYYCLPVDVGFAPECT
VEQALERTFMTERIYDSEHEQHLKKTLRLGHLPSILFLQLRRWAVTREGELVKLDNVVRI
KRTLLIPRTICGDETLGNTERTYRLLSVVCHRGDAVSRGHYVTYLVHHAATPAVLKVQSS
DPGNKDTAILRSPPDTATVILCNDANISVCPAKNMEKETMYFLVYQKTS
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgaataacagcaacttctgcttcatgaattcgatgctgcaggcactcatgtttattccc
ccctttgcgcaactgtccgtctccgtcagctgtgatgcgcaggtacgccagctgtgcccc
acactggcgactcttggaaagtggacacttcagtactggaagcccggtttcacgcggcta
ccgatgatagccccaatgttgatgccacgcatgcctgcgggcgccaagagcagtaatagc
ggcgctcctcggtcggccgtgatccccacgtcgcagcggatccttgacggctctgtgcag
gaggacgcgcaggaatttctccagaagttgctggagcgtgtgtatgaagagctggtgagt
ctcgaggaagcttttcagcaggccgacgcgtctgaggcagctacggagagcgatatgggg
tcgaatgcccctgctgtcgcggcgagcagcgccagtggtgatgaccgcaccgatgctcga
gacgacgccaccacctcgaccttccagaagaagggctggacgtttgtgaagggaaaggag
aagctggcggtgcgggagtacgaggatgcgcaagggcagtcaaaactaatggccagtatc
tttggtggcacgctggagagccacttgcaggggaagcagcgccagcgcaaccgtgtgtcg
gtgctcatcgagaagtactactgtctccccgtcgacgttggctttgcgcccgagtgtacg
gttgagcaagctctcgagcggaccttcatgacagagcgcatctatgacagcgagcatgag
cagcacctcaagaagacgctccgcctcggtcatctgccctctattctctttctgcagctg
cgccgctgggccgtgacgcgcgagggcgagctcgtgaagctcgacaacgttgtgcgtatc
aagcgcaccttgctgattccccgcaccatctgcggtgatgagaccctgggcaacacagag
cgaacgtaccgtctcttgtcagtggtgtgccaccgcggtgacgccgttagtcgggggcac
tatgtcacctacttggtgcaccacgccgcgaccccagcggtcctgaaggtgcagtcgagt
gatccgggcaacaaggacactgcgatcctgcgctcgccgcctgacacggcgacagtgatt
ctctgtaatgacgccaacatttctgtgtgtccagcaaagaacatggaaaaggagaccatg
tactttctcgtctaccaaaagacaagctga

DBGET integrated database retrieval system