KEGG   Leishmania mexicana: LMXM_31_2910Help
Entry
LMXM_31_2910      CDS       T02288                                 

Definition
cysteine peptidase, Clan CA, family C19,putative
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
lmi  Leishmania mexicana
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
31
AA seq 1340 aa AA seqDB search
MSSDGALRSGDAMEEMELKERNHSIEGSSFTATTRESFASAEEDSTVSQANEEACMPTGK
PRTITWNGTTTAAHEYTAASTAATDDEENAPVVAQPQPPLDRLQAYIQVLVGNILEGLRG
FDGSITWLKRSHSAIAVHLDSVNAGGVPAATEEFSVAWFGIASAVLRDLIQESVADISAF
ATPPLPSCENEEAARGLCVTPRELSVAFVSGLQSIVSEVMNDGGCHGPGGSHHFSRYSLR
SFAHVKEISEMSRRLMEEHLTQGAHVPHALRNKYSDDTTPIDCKEDLCSILQSTADAWVC
SFFPAYQQRSRNPTEVEPFLWGEEEDASRLNLELFFYCLYFACQQRSLMQNKEALPRGVV
VPTAWIEQLLRWSTQAKEQHCLASPGPHPPFPGPIDTFALMTVSPHDPRRHWLSLDSERY
QVIPETLYNSFFDFFGSGPKYVMYGAFPLRERCLLMWKPLPLTVFTTFEWWEGNESDGTL
DKYSVEVPVEEALLHSDMREVCHLAWGVMSEEEGMMSDKAARVWFAAINGTDTVCIWCKG
LYMLSMKTGPFAIAEKGNGMDLTVQEILQQLRRRMEQYMPESMEEWRLQTSGKVLLSMVL
TLNNTNGDDRGGEITGTMEVAAHQCGVCGLTNVGNTCYMNSALQCLSNLTSFRTKLLTLP
VSHFSQAVITPLLIRLLTTMWSGQHSFAETRELKEQIGMRVKRFSGYQQQDANEFIEVLL
DHLSEEINLLSERCYRQREDSDKAIATQELSTIFWNNFLENNRSFIPPLFFHQSKTVFTC
LTCGERSTVFDNNVTLSVSIKDPPQRRAMSVDVMVELSKPDDAAQPASHSGFIAPVFRPV
KGGTARAHALLTLKVHVLVQPDNTVREEEVEEALQQLLLSNASASSEVLGFFLEGSAEMT
AEEEEQRARSLAARLQVDVRVMDIPDHGRVFAWARCYLASAELSAAPVPPSTTVGAPGTP
GARVWYFIKDAPLPSTTVIMGTPVWIDEFPASYGAEHPQPAAADIADAEELVSASEPHDC
MSAYAEHIRPRSLEVVAALLQRVPEDETDDVALFSATEALGGGVGYVMPPSYKDEGKENL
ASANDAGAAAASIERDIKITQRILRKATTARITKATSTGGDITTDATGSEACEKVPASTA
VTITIVVCIQYDSGKYQLVTGGWRSDAFGLRGVGSDITPEVKCSLHECLSHSMQPDLLRG
EDAWFCSRCKEFRETKVHRTLFRLPPCLIVSFKRFKMHTYSADKKNTTVQFPSELDFAPY
LDPEASGLQAEGTKYRLRGVVYHTGSLSFGHYTAAAFNDSVRKWVYYNDTHATIDSCDAP
APHGAYILCFERVEATPSSG
NT seq 4023 nt NT seq  +upstreamnt  +downstreamnt
atgagctctgacggcgccctgaggtctggggacgctatggaggagatggagctaaaggaa
agaaaccacagcattgaagggtcttcgtttaccgccactacccgtgagagcttcgcttct
gcagaagaagactcgacagtgtcacaggccaacgaagaagcgtgcatgcccaccggcaag
ccgagaaccataacttggaatggcacgactacggcagcgcatgaatacaccgctgcttct
acggctgcaacggacgacgaggagaatgctcccgtggtggcgcagccgcagcctccgctc
gatcgactccaggcttatattcaggtgcttgtgggcaacatcttggagggccttcgcggg
ttcgacggcagcatcacatggctaaagcgctcacattcggccatcgcagtccacttagac
agcgtcaacgccgggggtgttccggccgcaacggaggagttcagcgttgcttggttcggt
atcgcaagcgctgtgctgcgtgacttgatccaagaaagcgtagcggacatttctgctttc
gcgacaccgcctcttccgtcctgcgagaatgaggaagcagcgcgtgggttgtgcgtgacg
ccgcgcgagctgtccgttgcctttgtctcgggtttgcagagcattgtttcggaggtgatg
aatgacggcgggtgccatggcccgggtggcagccaccacttcagtcgctactctttgcgc
agtttcgcccatgtaaaggagatcagcgagatgagccgccgtctcatggaggaacacttg
acgcagggagcacacgtgccacacgcgctgcgcaacaagtacagcgacgatacgacccct
atcgactgcaaggaggacctctgctccattctccagagcactgctgatgcgtgggtgtgc
agcttcttcccagcctaccagcagcgctctcgcaacccaacagaggtggagccgtttttg
tggggggaggaagaggacgcctcgcgcctcaacctggagctgttcttttactgcttgtac
tttgcttgtcagcagcggagcttgatgcagaacaaggaagctcttccgcgcggcgttgtg
gtgccgacggcgtggattgagcagctgctgaggtggtccacgcaagcgaaggagcagcac
tgcttggcctcacccggaccacacccaccttttccaggcccgatcgacacgttcgcgctc
atgacggtctcgccgcacgacccgcgccggcactggctttctctagactcagagcgatac
caggtgattccagagactctgtacaattccttctttgacttctttggctccggccccaag
tacgtcatgtatggagcctttcctctgcgagagcgctgtctcctcatgtggaagccactt
ccgctgaccgtgttcacgacatttgagtggtgggaggggaacgagtcggacggaacgctt
gacaagtacagcgtagaggtgccagtggaggaggcactcctgcatagcgacatgcgcgag
gtgtgccaccttgcctggggcgtgatgagcgaggaggagggtatgatgtcggacaaggca
gccagggtgtggtttgcggcaatcaacggaaccgacacggtgtgcatctggtgcaaaggc
ctctacatgctttccatgaaaacagggccgttcgcgattgcagaaaaggggaatgggatg
gacctgaccgtgcaggagatattgcagcagctgcggcgacgtatggagcagtatatgccg
gagagcatggaggagtggaggctgcagacgagcgggaaggtgctcctgtccatggtgctg
acgctgaacaacacaaacggcgacgaccgcgggggcgaaattacaggcacaatggaggtg
gcggcacaccaatgcggtgtgtgcggcctgaccaatgtcggcaacacgtgctacatgaac
agtgcccttcagtgcttgtcgaacctcacctcctttcgcacgaagcttttgacgcttcct
gtttcgcacttttcacaggcggtgataactccgctgctcattaggcttctgacgacgatg
tggtctgggcagcactccttcgcagagacccgtgaacttaaggagcagattggtatgaga
gtgaagcggttttctggctaccagcagcaagatgcgaatgagttcatagaagtgctcctg
gaccatctgagtgaggagatcaatctcctctcggagcgatgctaccgacagcgcgaagac
agcgacaaggcgatcgcgacgcaggagctctccaccatcttctggaacaacttcttggag
aacaacaggtcgttcataccgcccctcttctttcaccagtcaaagaccgtcttcacgtgc
ctcacgtgtggggaacgcagcaccgtcttcgacaacaacgtcacgctctccgtcagcatc
aaagacccgccgcaacgacgtgccatgagcgtggatgttatggtggagctaagcaagcct
gacgacgcagcgcagcccgcttcacacagcggctttatagcaccggtgtttcgacctgtg
aaggggggcacggcccgtgcgcacgcgctgctgacgctgaaggttcacgtgctggtgcag
cccgacaacacggtgcgcgaggaggaggtggaggaggcgcttcagcagctgctgctgagc
aatgccagtgctagcagcgaggtgctagggttttttctcgagggctctgcagagatgact
gcggaggaggaggagcagagggcaaggagtttggcagcgcgtctgcaggtggacgtgcgc
gtaatggacattcctgatcacggtcgcgtgtttgcttgggcacggtgctacctggcgagc
gcagagctgagcgcggcacctgtgccgccatcgactacagtgggcgccccagggacgcct
ggggcacgtgtgtggtactttatcaaggacgcgcctcttccctccacgactgtcataatg
ggcaccccggtttggattgacgagtttccggcgtcttacggtgcggagcacccgcagcca
gcggctgcagatatcgctgacgcggaggagctcgtttctgccagcgaaccccatgactgc
atgagcgcctacgcggagcacatccgaccgcgctctttagaggtggtggcagcactgctg
caacgcgttccagaggacgagacggatgatgtagcgctcttcagtgccacagaggctcta
ggcggaggggtagggtacgtcatgcctccatcttacaaggatgaaggcaaagaaaacctg
gcgtctgcaaacgacgccggcgcagcggctgcatccatcgagcgggacatcaagataact
cagcgcattctccgcaaagccacaaccgccaggatcacaaaagccacatccacgggtggc
gacatcaccacagacgcgacagggagcgaggcctgtgaaaaggtgcctgcttccacggcg
gtgacgatcaccattgtcgtgtgcatccagtacgactctggcaagtatcagctcgtcacc
ggcggatggaggtcagacgcctttggactccgcggcgtaggtagcgacatcaccccggag
gtaaaatgctcgctgcacgagtgcttgtcgcactctatgcagccggacctgctgcggggc
gaggatgcgtggttctgcagtcggtgcaaggagttccgggagacgaaggtgcaccgcacc
ctcttccgtctgcccccgtgcctcattgtgtcctttaagcgctttaagatgcacacgtac
agcgccgacaagaagaacaccacagtgcagttccccagcgagctcgactttgcgccgtac
ctggacccagaggcctctggacttcaggcggagggcacgaagtaccgcctgcgcggtgtg
gtgtaccacactgggtcgctcagctttggacattacactgcggccgccttcaacgattcc
gtgaggaaatgggtatactacaacgacacacacgcgacgatcgatagctgcgacgcccca
gcgccgcacggggcgtacattttgtgctttgagcgcgttgaggctacgccaagctcagga
taa

DBGET integrated database retrieval system