KEGG   Leishmania mexicana: LMXM_33_3380Help
Entry
LMXM_33_3380      CDS       T02288                                 

Definition
aldose 1-epimerase-like protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
lmi  Leishmania mexicana
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lmi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMXM_33_3380
Enzymes [BR:lmi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     LMXM_33_3380
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
33
AA seq 301 aa AA seqDB search
MVAFTPDSRGRNSVTIHNKDGSSITVYEQGAHVSSWKTKDGKEHLYLSPTAIFADRTALR
GGVPLIFPQFGAYGPLQPSHGFARIRSWNIEDAQSGMATFSLRVSLCELLPDDSSLTDSP
QNAINLLYTICFSNTELKLRMKVTNTSEEQSAPFQFAFHTYFAVSDISQTVVSGVNSSPF
VDNCKARGNPNTPPSPPEQLWIIRGEHDRIYPDQACAIVLQDLGAKVTLQISSPNLSDVC
LWNPGESKCASMKDMPPDGYKHFVCVEHGKMLKKVVVPPCSSWTGTQEIAITAESPCESN
I
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggttgccttcactcccgactcccgcgggcgcaacagcgtcaccatccacaacaaagac
ggctccagcattaccgtctacgagcagggcgcgcacgtcagcagctggaagaccaaggat
ggcaaagagcatctgtacctcagccccactgccatctttgctgaccgcaccgccctgcgc
ggtggcgtgccgctgatcttcccgcagttcggggcatacggcccactgcagccgtcgcac
ggcttcgcgcgcattcgttcgtggaacatcgaggatgcccagagcggcatggcgaccttc
tcgctgcgcgtgtcgctgtgcgagctgctgccggacgactcttctcttacagattccccg
cagaacgccattaacctgctctacacaatttgcttcagcaacaccgagctgaagctccga
atgaaggtcacgaacacgagcgaggagcagtcagcaccgtttcagttcgcctttcacaca
tatttcgcagtgtccgacatttcgcagacggtggtcagcggcgtcaacagctcccctttt
gtcgacaactgcaaggcgcgcggcaacccgaacacaccgccaagcccaccggagcaactg
tggattattcgcggcgagcacgaccgcatttaccccgaccaagcgtgcgccatcgtcctc
caggacctgggcgcgaaggttacgcttcaaatctccagtcctaacctaagcgacgtgtgc
ctctggaaccccggtgagtccaagtgcgcttcgatgaaggacatgccaccggatggctac
aagcactttgtgtgtgtagagcacggaaaaatgctgaaaaaggtggtggtgccgccgtgc
tcgagctggacaggcacgcaggagatcgccatcacagctgaaagcccttgtgagtcgaac
atatag

DBGET integrated database retrieval system